Identifiers and Description

Gene Model Identifier

TTHERM_00086780

Standard Name

CCF12 (C-terminal Crystallin Fold)

Aliases

PreTt16427 | 6.m00501 | 3836.m02094

Description

C-terminal crystallin fold protein; domain structure and protein isolation suggest localization in dense core granules; contains signal peptide and 6 tandem repeats of an 80-residue motif conserved among CCF9, CCF10, CCF11, and CCF12

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 88.9%

TetraMine Data

TTHERM_00086780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05799.12.0009157491910723e-107hypothetical protein (772 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7

Sequences

>TTHERM_00086780(coding)
ATGGGTAAATTAAGAAGTTTGATCTTAATCGCTTTGCTTTTTACTTCCGTATATTGTGCC
TGCGACTATACTATAAGTCAAGGTAACTATAGTGGTGGCTGTGCTTAAAACTGTAAAGAT
TTCGATACTATTGAAAAAGCTAAGGCTGCTTGTGATGCTGATACCTCTTGTTAAGGTGTT
ACTTTTAGTTAAAAAGGAAGTGGTGGTAGCGCTTCTACTGGAGCCAGCGGAAACGGCTGG
GGCTATTAATTAAGAGCTTCTTAGAGCACTAGTCACTCACCTTCTGGTGAAACCTCCTGG
ATTAAGGGTTAATGTCAACCTACATTTGAGTGTGATTTCTAACCTTATCCAGGTTAATAC
TTAGGAGGATGCTTTAATGGATGTCAAGATTTTAAAAATTTAGAAGATGCTTTATAAGCT
TGTAGATAATAAAGTGGATGTGGTGGTGTAACCTTCTCTAAAAAATCTATTGGTGGACCC
AATGCAACCAATGCATTCGATGGAAGTTGGGGTTATCAATTGAGATCTAGTACTACTGCT
AGCGGTTCTCCTAATGGTGAAGATTCCTGGGGAAAGATAAATTGCAGCAATTATTAATAA
GGTGATTGCTACGTTCTTCATCCCGGTGATTATAGTGGTGGTTGTGCTTAAAATTGTAAG
GATTTCTCTTCTCTAAGCTAAGCTAAGGCTGCATGCAACAGCGATTCTTCTTGTAAAGGC
ATTACATTTAGTTCTCCAAGCGGTGGTGGTAGTTAATCTTCAGGCGCTGTTGGTAACGGC
TGGGGTTATCAATTAAGAGCTTCTTCTACCACAAATCACTCTCCTTCAGGTGAAAATTCT
TGGGTTAAAACTGATTGTTCAAATTTATTCCCTTGTGATTTCTTACCTTCTTAAGGTTAT
TACATTGGTGGATGTTTCAACAATTGCTAAGATTTTAAAACCTTAGCTGAAGCTTAAGCT
GCTTGTAGATAATAAGCTGGATGTGGAGGTGTAAGTTTCTCTAAGAAATCAATAGGTGGT
TCCAGTGCTACCAATGCATTTGACGGTGCTTGGGGTTATTAATTGAGATCAGGTAAAAAC
TTAGTTCTCTCTCCCAACGGTGAAGATTCATGGTTAAAGTAAAGCTGTGGTTAATATACT
TAAATTTCATCTCAATGCATTTATTCTTATAATCCTGGTGATTATAGTGGTGGTTGCGCT
TAAAATTGCAAAGATTTCGCTAATATTGAAGATGCTAAAAACGCTTGTAACGCTGATCCC
AACTGTAATGCAGTTACTTTTAGTCAAAGAAATAGCGGAGGTGGTGCTTCAACCGGTGCT
AGCGGCAATGGATGGGGATACTAATTGAGAGCTACAAAGGGAAGTACTCATTCACCATCT
GGAGAAACTACTTGGGTCAAGTAAAGCTGTTAACCTGCTACTACTTTCCCTTGTTTCTTC
CAATAAGCTTCTTAAGGTTATTATTTGGGAGGTTGCTATGATAGTTGCAGAGACTATTCC
AATTTAAAAGACGCCTAAAATGCTTGCTTAAACAAATCAGGTTGTGGTGGTGTTACTTTC
TCCAAGAAAAATATTGGTGGATCTAATGCCTCTAATGCTTTTGATGGATTTTGGGGTTAT
TAATTAAGACAAAGCACTACTCCTTCACTTTCTCCTAACGGTGAAGATTCCTGGGTCTAA
GTTTGCTTAAATTATCCTGCCCTCTTTACAGGATGTAATTTCACAGGACAAATGGTCGCA
TTCCCTCCTGGTGTATAAGTTCCTTCTCTTAACTTATCATAATACCACAGTTTATATGTT
CCTTCTGGCTAATATCTTAACTTGTATAACTAATCCAATTAGAAGGGTTAAGCTACTAAT
TATTCAAGCTCTGTATCTTGTTTACCCCAAGGATTCATGTTGATGATTCAACAACCTCAC
TCTATCTCTACCCATAAATCTGTAGAGAATAAGCTTAAGAAAAATAGACAATGA


>TTHERM_00086780(protein)
MGKLRSLILIALLFTSVYCACDYTISQGNYSGGCAQNCKDFDTIEKAKAACDADTSCQGV
TFSQKGSGGSASTGASGNGWGYQLRASQSTSHSPSGETSWIKGQCQPTFECDFQPYPGQY
LGGCFNGCQDFKNLEDALQACRQQSGCGGVTFSKKSIGGPNATNAFDGSWGYQLRSSTTA
SGSPNGEDSWGKINCSNYQQGDCYVLHPGDYSGGCAQNCKDFSSLSQAKAACNSDSSCKG
ITFSSPSGGGSQSSGAVGNGWGYQLRASSTTNHSPSGENSWVKTDCSNLFPCDFLPSQGY
YIGGCFNNCQDFKTLAEAQAACRQQAGCGGVSFSKKSIGGSSATNAFDGAWGYQLRSGKN
LVLSPNGEDSWLKQSCGQYTQISSQCIYSYNPGDYSGGCAQNCKDFANIEDAKNACNADP
NCNAVTFSQRNSGGGASTGASGNGWGYQLRATKGSTHSPSGETTWVKQSCQPATTFPCFF
QQASQGYYLGGCYDSCRDYSNLKDAQNACLNKSGCGGVTFSKKNIGGSNASNAFDGFWGY
QLRQSTTPSLSPNGEDSWVQVCLNYPALFTGCNFTGQMVAFPPGVQVPSLNLSQYHSLYV
PSGQYLNLYNQSNQKGQATNYSSSVSCLPQGFMLMIQQPHSISTHKSVENKLKKNRQ


>TTHERM_00086780(gene)
ATTTTTAATTAATTAACAAATAAGCAAAAATTAAATTTTAGAATGGGTAAATTAAGAAGT
TTGATCTTAATCGCTTTGCTTTTTACTTCCGTATATTGTGCCTGCGACTATACTATAAGT
CAAGGTAACTATAGTGGTGGCTGTGCTTAAAACTGTAAAGATTTCGATACTATTGAAAAA
GCTAAGGCTGCTTGTGATGCTGATACCTCTTGTTAAGGTGTTACTTTTAGTTAAAAAGGA
AGTGGTGGTAGCGCTTCTACTGGAGCCAGCGGAAACGGCTGGGGCTATTAATTAAGAGCT
TCTTAGAGCACTAGTCACTCACCTTCTGGTGAAACCTCCTGGATTAAGGGTTAATGTCAA
CCTACATTTGAGTGTGATTTCTAACCTTATCCAGGTTAATACTTAGGAGGATGCTTTAAT
GGATGTCAAGATTTTAAAAATTTAGAAGATGCTTTATAAGCTTGTAGATAATAAAGTGGA
TGTGGTGGTGTAACCTTCTCTAAAAAATCTATTGGTGGACCCAATGCAACCAATGCATTC
GATGGAAGTTGGGGTTATCAATTGAGATCTAGTACTACTGCTAGCGGTTCTCCTAATGGT
GAAGATTCCTGGGGAAAGATAAATTGCAGCAATTATTAATAAGGTGATTGCTACGTTCTT
CATCCCGGTGATTATAGTGGTGGTTGTGCTTAAAATTGTAAGGATTTCTCTTCTCTAAGC
TAAGCTAAGGCTGCATGCAACAGCGATTCTTCTTGTAAAGGCATTACATTTAGTTCTCCA
AGCGGTGGTGGTAGTTAATCTTCAGGCGCTGTTGGTAACGGCTGGGGTTATCAATTAAGA
GCTTCTTCTACCACAAATCACTCTCCTTCAGGTGAAAATTCTTGGGTTAAAACTGATTGT
TCAAATTTATTCCCTTGTGATTTCTTACCTTCTTAAGGTTATTACATTGGTGGATGTTTC
AACAATTGCTAAGATTTTAAAACCTTAGCTGAAGCTTAAGCTGCTTGTAGATAATAAGCT
GGATGTGGAGGTGTAAGTTTCTCTAAGAAATCAATAGGTGGTTCCAGTGCTACCAATGCA
TTTGACGGTGCTTGGGGTTATTAATTGAGATCAGGTAAAAACTTAGTTCTCTCTCCCAAC
GGTGAAGATTCATGGTTAAAGTAAAGCTGTGGTTAATATACTTAAATTTCATCTCAATGC
ATTTATTCTTATAATCCTGGTGATTATAGTGGTGGTTGCGCTTAAAATTGCAAAGATTTC
GCTAATATTGAAGATGCTAAAAACGCTTGTAACGCTGATCCCAACTGTAATGCAGTTACT
TTTAGTCAAAGAAATAGCGGAGGTGGTGCTTCAACCGGTGCTAGCGGCAATGGATGGGGA
TACTAATTGAGAGCTACAAAGGGAAGTACTCATTCACCATCTGGAGAAACTACTTGGGTC
AAGTAAAGCTGTTAACCTGCTACTACTTTCCCTTGTTTCTTCCAATAAGCTTCTTAAGGT
TATTATTTGGGAGGTTGCTATGATAGTTGCAGAGACTATTCCAATTTAAAAGACGCCTAA
AATGCTTGCTTAAACAAATCAGGTTGTGGTGGTGTTACTTTCTCCAAGAAAAATATTGGT
GGATCTAATGCCTCTAATGCTTTTGATGGATTTTGGGGTTATTAATTAAGACAAAGCACT
ACTCCTTCACTTTCTCCTAACGGTGAAGATTCCTGGGTCTAAGTTTGCTTAAATTATCCT
GCCCTCTTTACAGGATGTAATTTCACAGGACAAATGGTCGCATTCCCTCCTGGTGTATAA
GTTCCTTCTCTTAACTTATCATAATACCACAGTTTATATGTTCCTTCTGGCTAATATCTT
AACTTGTATAACTAATCCAATTAGAAGGGTTAAGCTACTAATTATTCAAGCTCTGTATCT
TGTTTACCCCAAGGATTCATGTTGATGATTCAACAACCTCACTCTATCTCTACCCATAAA
TCTGTAGAGAATAAGCTTAAGAAAAATAGACAATGA