Identifiers and Description

Gene Model Identifier

TTHERM_00086780

Standard Name

CCF12 (C-terminal Crystallin Fold 12)

Aliases

PreTt16427 | 6.m00501 | 3836.m02094

Description

CCF12 carboxy-terminal crystallin fold protein 12p; C-terminal crystallin fold protein; domain structure and protein isolation suggest localization in dense core granules; contains signal peptide and 6 tandem repeats of an 80-residue motif conserved among CCF9- CCF10- CCF11- and CCF12

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 88.9%

TetraMine Data

TTHERM_00086780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05799.12.0009157491910723e-107hypothetical protein (772 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7

Sequences

>TTHERM_00086780(coding)
ATGGGTAAATTAAGAAGTTTGATCTTAATCGCTTTGCTTTTTACTTCCGTATATTGTGCC
TGCGACTATACTATAAGTCAAGGTAACTATAGTGGTGGCTGTGCTTAAAACTGTAAAGAT
TTCGATACTATTGAAAAAGCTAAGGCTGCTTGTGATGCTGATACCTCTTGTTAAGGTGTT
ACTTTTAGTTAAAAAGGAAGTGGTGGTAGCGCTTCTACTGGAGCCAGCGGAAACGGCTGG
GGCTATTAATTAAGAGCTTCTTAGAGCACTAGTCACTCACCTTCTGGTGAAACCTCCTGG
ATTAAGGGTTAATGTCAACCTACATTTGAGTGTGATTTCTAACCTTATCCAGGTTAATAC
TTAGGAGGATGCTTTAATGGATGTCAAGATTTTAAAAATTTAGAAGATGCTTTATAAGCT
TGTAGATAATAAAGTGGATGTGGTGGTGTAACCTTCTCTAAAAAATCTATTGGTGGACCC
AATGCAACCAATGCATTCGATGGAAGTTGGGGTTATCAATTGAGATCTAGTACTACTGCT
AGCGGTTCTCCTAATGGTGAAGATTCCTGGGGAAAGATAAATTGCAGCAATTATTAATAA
GGTGATTGCTACGTTCTTCATCCCGGTGATTATAGTGGTGGTTGTGCTTAAAATTGTAAG
GATTTCTCTTCTCTAAGCTAAGCTAAGGCTGCATGCAACAGCGATTCTTCTTGTAAAGGC
ATTACATTTAGTTCTCCAAGCGGTGGTGGTAGTTAATCTTCAGGCGCTGTTGGTAACGGC
TGGGGTTATCAATTAAGAGCTTCTTCTACCACAAATCACTCTCCTTCAGGTGAAAATTCT
TGGGTTAAAACTGATTGTTCAAATTTATTCCCTTGTGATTTCTTACCTTCTTAAGGTTAT
TACATTGGTGGATGTTTCAACAATTGCTAAGATTTTAAAACCTTAGCTGAAGCTTAAGCT
GCTTGTAGATAATAAGCTGGATGTGGAGGTGTAAGTTTCTCTAAGAAATCAATAGGTGGT
TCCAGTGCTACCAATGCATTTGACGGTGCTTGGGGTTATTAATTGAGATCAGGTAAAAAC
TTAGTTCTCTCTCCCAACGGTGAAGATTCATGGTTAAAGTAAAGCTGTGGTTAATATACT
TAAATTTCATCTCAATGCATTTATTCTTATAATCCTGGTGATTATAGTGGTGGTTGCGCT
TAAAATTGCAAAGATTTCGCTAATATTGAAGATGCTAAAAACGCTTGTAACGCTGATCCC
AACTGTAATGCAGTTACTTTTAGTCAAAGAAATAGCGGAGGTGGTGCTTCAACCGGTGCT
AGCGGCAATGGATGGGGATACTAATTGAGAGCTACAAAGGGAAGTACTCATTCACCATCT
GGAGAAACTACTTGGGTCAAGTAAAGCTGTTAACCTGCTACTACTTTCCCTTGTTTCTTC
CAATAAGCTTCTTAAGGTTATTATTTGGGAGGTTGCTATGATAGTTGCAGAGACTATTCC
AATTTAAAAGACGCCTAAAATGCTTGCTTAAACAAATCAGGTTGTGGTGGTGTTACTTTC
TCCAAGAAAAATATTGGTGGATCTAATGCCTCTAATGCTTTTGATGGATTTTGGGGTTAT
TAATTAAGACAAAGCACTACTCCTTCACTTTCTCCTAACGGTGAAGATTCCTGGGTCTAA
GTTTGCTTAAATTATCCTGCCCTCTTTACAGGATGTAATTTCACAGGACAAATGGTCGCA
TTCCCTCCTGGTGTATAAGTTCCTTCTCTTAACTTATCATAATACCACAGTTTATATGTT
CCTTCTGGCTAATATCTTAACTTGTATAACTAATCCAATTAGAAGGGTTAAGCTACTAAT
TATTCAAGCTCTGTATCTTGTTTACCCCAAGGATTCATGTTGATGATTCAACAACCTCAC
TCTATCTCTACCCATAAATCTGTAGAGAATAAGCTTAAGAAAAATAGACAATGA


>TTHERM_00086780(protein)
MGKLRSLILIALLFTSVYCACDYTISQGNYSGGCAQNCKDFDTIEKAKAACDADTSCQGV
TFSQKGSGGSASTGASGNGWGYQLRASQSTSHSPSGETSWIKGQCQPTFECDFQPYPGQY
LGGCFNGCQDFKNLEDALQACRQQSGCGGVTFSKKSIGGPNATNAFDGSWGYQLRSSTTA
SGSPNGEDSWGKINCSNYQQGDCYVLHPGDYSGGCAQNCKDFSSLSQAKAACNSDSSCKG
ITFSSPSGGGSQSSGAVGNGWGYQLRASSTTNHSPSGENSWVKTDCSNLFPCDFLPSQGY
YIGGCFNNCQDFKTLAEAQAACRQQAGCGGVSFSKKSIGGSSATNAFDGAWGYQLRSGKN
LVLSPNGEDSWLKQSCGQYTQISSQCIYSYNPGDYSGGCAQNCKDFANIEDAKNACNADP
NCNAVTFSQRNSGGGASTGASGNGWGYQLRATKGSTHSPSGETTWVKQSCQPATTFPCFF
QQASQGYYLGGCYDSCRDYSNLKDAQNACLNKSGCGGVTFSKKNIGGSNASNAFDGFWGY
QLRQSTTPSLSPNGEDSWVQVCLNYPALFTGCNFTGQMVAFPPGVQVPSLNLSQYHSLYV
PSGQYLNLYNQSNQKGQATNYSSSVSCLPQGFMLMIQQPHSISTHKSVENKLKKNRQ


>TTHERM_00086780(gene)
ATGGGTAAATTAAGAAGTTTGATCTTAATCGCTTTGCTTTTTACTTCCGTATATTGTGCC
TGCGACTATACTATAAGTCAAGGTAACTATAGTGGTGGCTGTGCTTAAAACTGTAAAGAT
TTCGATACTATTGAAAAAGCTAAGGCTGCTTGTGATGCTGATACCTCTTGTTAAGGTGTT
ACTTTTAGTTAAAAAGGAAGTGGTGGTAGCGCTTCTACTGGAGCCAGCGGAAACGGCTGG
GGCTATTAATTAAGAGCTTCTTAGAGCACTAGTCACTCACCTTCTGGTGAAACCTCCTGG
ATTAAGGGTTAATGTCAACCTACATTTGAGTGTGATTTCTAACCTTATCCAGGTTAATAC
TTAGGAGGATGCTTTAATGGATGTCAAGATTTTAAAAATTTAGAAGATGCTTTATAAGCT
TGTAGATAATAAAGTGGATGTGGTGGTGTAACCTTCTCTAAAAAATCTATTGGTGGACCC
AATGCAACCAATGCATTCGATGGAAGTTGGGGTTATCAATTGAGATCTAGTACTACTGCT
AGCGGTTCTCCTAATGGTGAAGATTCCTGGGGAAAGATAAATTGCAGCAATTATTAATAA
GGTGATTGCTACGTTCTTCATCCCGGTGATTATAGTGGTGGTTGTGCTTAAAATTGTAAG
GATTTCTCTTCTCTAAGCTAAGCTAAGGCTGCATGCAACAGCGATTCTTCTTGTAAAGGC
ATTACATTTAGTTCTCCAAGCGGTGGTGGTAGTTAATCTTCAGGCGCTGTTGGTAACGGC
TGGGGTTATCAATTAAGAGCTTCTTCTACCACAAATCACTCTCCTTCAGGTGAAAATTCT
TGGGTTAAAACTGATTGTTCAAATTTATTCCCTTGTGATTTCTTACCTTCTTAAGGTTAT
TACATTGGTGGATGTTTCAACAATTGCTAAGATTTTAAAACCTTAGCTGAAGCTTAAGCT
GCTTGTAGATAATAAGCTGGATGTGGAGGTGTAAGTTTCTCTAAGAAATCAATAGGTGGT
TCCAGTGCTACCAATGCATTTGACGGTGCTTGGGGTTATTAATTGAGATCAGGTAAAAAC
TTAGTTCTCTCTCCCAACGGTGAAGATTCATGGTTAAAGTAAAGCTGTGGTTAATATACT
TAAATTTCATCTCAATGCATTTATTCTTATAATCCTGGTGATTATAGTGGTGGTTGCGCT
TAAAATTGCAAAGATTTCGCTAATATTGAAGATGCTAAAAACGCTTGTAACGCTGATCCC
AACTGTAATGCAGTTACTTTTAGTCAAAGAAATAGCGGAGGTGGTGCTTCAACCGGTGCT
AGCGGCAATGGATGGGGATACTAATTGAGAGCTACAAAGGGAAGTACTCATTCACCATCT
GGAGAAACTACTTGGGTCAAGTAAAGCTGTTAACCTGCTACTACTTTCCCTTGTTTCTTC
CAATAAGCTTCTTAAGGTTATTATTTGGGAGGTTGCTATGATAGTTGCAGAGACTATTCC
AATTTAAAAGACGCCTAAAATGCTTGCTTAAACAAATCAGGTTGTGGTGGTGTTACTTTC
TCCAAGAAAAATATTGGTGGATCTAATGCCTCTAATGCTTTTGATGGATTTTGGGGTTAT
TAATTAAGACAAAGCACTACTCCTTCACTTTCTCCTAACGGTGAAGATTCCTGGGTCTAA
GTTTGCTTAAATTATCCTGCCCTCTTTACAGGATGTAATTTCACAGGACAAATGGTCGCA
TTCCCTCCTGGTGTATAAGTTCCTTCTCTTAACTTATCATAATACCACAGTTTATATGTT
CCTTCTGGCTAATATCTTAACTTGTATAACTAATCCAATTAGAAGGGTTAAGCTACTAAT
TATTCAAGCTCTGTATCTTGTTTACCCCAAGGATTCATGTTGATGATTCAACAACCTCAC
TCTATCTCTACCCATAAATCTGTAGAGAATAAGCTTAAGAAAAATAGACAATGA