Identifiers and Description

Gene Model Identifier

TTHERM_00585170

Standard Name

CCF11 (C-terminal Crystallin Fold 11)

Aliases

PreTt04123 | 80.m00169 | 3675.m00067

Description

C-terminal crystallin fold protein; domain structure suggests localization in dense core granules; contains signal peptide and tandem 80-residue motif with 6 cysteines conserved among CCF9, CCF10, CCF11, and CCF12

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF07673 ) Protein of unknown function (DUF1602)
  • ( PF01391 ) Collagen triple helix repeat (20

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 80.2%

TetraMine Data

TTHERM_00585170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15194.17.999856284897459e-146dentin sialophosphoprotein (55
1 aa)
WormBaseWBGene000006360.00000000039982266684865623locus:col-60 status:Partiall
y_confirmed UniProt:Q19725
protein_id:CAA95812.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7

Sequences

>TTHERM_00585170(coding)
ATGCAAGGAAAATTAATAGTATTATTTGCATGCCTTATGGTAGCAAGTTATGCACAGACT
CGTTGCTGGAATGATTATTCAGTAATGAAAAAAGGTGTTTTGGCATCTTGTGTTGATGGT
TGCAGAGATTATCCAACTCTTGATGCTGCCGCAGAAGCATGTGATTAAAATAAGCTTTGT
GATGGTGTTTCTAATGAATTTAAATCTAATGGTGGTAGCAACTCATTAGGCCCTAATGCT
CTTAGTGGTTGGTAATTGAGAAAAGGTGATCTTTAAGTTAATTATAAGTATAACTAATAA
GGATATACATTTTTGAAAGGAACTTAATTTTGCAACATTAACAATGTTATGTATGGTGGT
CCTATTTTTGATTACACAATTAAGAAAAATTGTGTTGAAAGTTCTTGTACTACTTATAAT
AATTGGTTAAATGCTGCTTAATAAGCTTAAAAGAATGGAAATGGAGATGCATCTATTACT
TTATTAAGTGATGGAAGCAACTGGGCACCTTACAAATTATAATAAATGTCTGCTAGTGAC
TATGCACTCAGCTTCTTCGTTTCATAATACTTAAACACTGAATATACCTCAGCCAAGAAT
CAATACTACGATGAAAAGAGAGGTTATACTCTTAGTACTTGTGTCAATAAATGCAAAGAC
TATGCTTCGTTAAAGGAAGCTTAATATTATTGTAACTAATCAGCTGAATGTGTTGGTGTT
ACATATCAAAGTATTGAAATTGATGCAGGTGATAACTCTGTAGGTTATATTTAAGGATAT
GGTTACTAACTTAGAAAGGGTTCTTTGAAAGCTAGCTCTGATGTTATTTCTTGGGTTAAA
TAGACTGGTCTTGCTAATAACCCTGCTACTACTCCCTCATCACCCTCATCCTCATCATCA
TCTAGTTCTAGCTCTAACTCTTCATCCTCTAGTTCATCAAGCTCAAGCTCCTCATCTAGT
TCATCTAGCTCATCATCAAGTTCAAGCTCAAGCTCCTCATCTAGCTCATCATCAAGTTCA
AGCTCATCAGGATCAAGTGGAAGCAGTTCTAATACTTCTTCTGGATCATCAGGATCAAGT
GGTTCATCTGGATCATCAGGATCAAGTGGTTCATCTGGATCATCAGGATCAAGTGGTTCA
TCAGGATCAAGTGGTTCATCAGGATCAAGTGGTTCATCTGGATCATCAGGATCAAGTGGT
TCATCTGGTTCATCAGGATCAAGTGGTTCATCTGGTTCATCAGGATCAAGTGGTTCATCT
GGATCAAGTGGTTCATCTGGTTCATCAGGATCAAGTGGTTCATCTGGTTCATCAGGATCA
AGTGGAAACAATTAAGGTACTCCATCTTCTACATAACCTACTGAATAAGCAGCTGGATGT
CCTATTCTTTATACTGAGTGCTACTATAGTGGTAATTCAGTATCAGTTTGTTCTAACAAT
CCTGACTTTAACTGGCGTCCTTACAAATCTCTCAAAATCCCAGATGGTTAATATGTAGTA
ATTTATGAAGAAGATAATTACAAGGGTGAAAAATACTACTACGATTAGAGCATTCCTTGT
TCTGATGATGTTTAATTATTCCTTTTTGAAAACAAGAAAAGCTTTGATGAATAAGAAAGT
GCTACTACCAGCCATAAAAAGCACCACAAAAAGAATCACCATAAGCTTAAAAAGAATTCA
GATTGA


>TTHERM_00585170(protein)
MQGKLIVLFACLMVASYAQTRCWNDYSVMKKGVLASCVDGCRDYPTLDAAAEACDQNKLC
DGVSNEFKSNGGSNSLGPNALSGWQLRKGDLQVNYKYNQQGYTFLKGTQFCNINNVMYGG
PIFDYTIKKNCVESSCTTYNNWLNAAQQAQKNGNGDASITLLSDGSNWAPYKLQQMSASD
YALSFFVSQYLNTEYTSAKNQYYDEKRGYTLSTCVNKCKDYASLKEAQYYCNQSAECVGV
TYQSIEIDAGDNSVGYIQGYGYQLRKGSLKASSDVISWVKQTGLANNPATTPSSPSSSSS
SSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSGSSSNTSSGSSGSS
GSSGSSGSSGSSGSSGSSGSSGSSGSSGSSGSSGSSGSSGSSGSSGSSGSSGSSGSSGSS
GSSGSSGSSGSSGSSGSSGSSGNNQGTPSSTQPTEQAAGCPILYTECYYSGNSVSVCSNN
PDFNWRPYKSLKIPDGQYVVIYEEDNYKGEKYYYDQSIPCSDDVQLFLFENKKSFDEQES
ATTSHKKHHKKNHHKLKKNSD


>TTHERM_00585170(gene)
TTATTTGTTAATAAACAATTGATTTTCAAACAATTAATTAAAAAACCGGATAAAATATAA
GACTTTTGCTTGTTGTTTGTTAATATGCAAGGAAAATTAATAGTATTATTTGCATGCCTT
ATGGTAGCAAGTTATGCACAGACTCGTTGCTGGAATGATTATTCAGTAATGAAAAAAGGT
GTTTTGGCATCTTGTGTTGATGGTTGCAGAGATTATCCAACTCTTGATGCTGCCGCAGAA
GCATGTGATTAAAATAAGCTTTGTGATGGTGTTTCTAATGAATTTAAATCTAATGGTGGT
AGCAACTCATTAGGCCCTAATGCTCTTAGGTAAATTTAATTATAAAATATGGCAGTCCCC
ACATATATCAACAATTGAATTCAATTTAAACACATTTAAAAAAGAAAATTATAATAAAAT
GCATGATTTAATCCATATTTTTTACAAATACTTTGTTAAATAAATAAAAAGTGGTTGGTA
ATTGAGAAAAGGTGATCTTTAAGTTAATTATAAGTATAACTAATAAGGATATACATTTTT
GAAAGGAACTTAATTTTGCAACAGTAAATACTCATTTTAATATTAGCTCAATTTATAACA
TCATATTTATCTCAACAGTTAACAATGTTATGTATGGTGGTCCTATTTTTGATTACACAA
TTAAGAAAAATTGTGTTGAAAGTTCTTGTACTACTTATAATAATTGGTTAAATGCTGCTT
AATAAGCTTAAAAGAATGGAAATGGAGATGCATCTATTACTTTATTAAGTGATGGAAGCA
ACTGGGCACCTTACAAATTATAATAAATGTCTGCTAGTGACTATGCACTCAGCTTCTTCG
TTTCATAATACTTAAACACTGAATGTATATTCATTAACTTAATAATATAATTTTTTATAA
GATTTTAAAAAGATTTTACTTTTATAAGAAAAAATATTTTAACAAATATTTATTAATTAA
GCCTTTATTTTGTTAACTTTTAAAGTTAATTTCTAATTAATTACTTTTAAAAAATTAAAA
ATTTTTAATTTATGCCTAAATTACTTATATTTTATAGATACCTCAGCCAAGAATCAATAC
TACGATGAAAAGAGAGGTTATACTCTTAGTACTTGTGTCAATAAATGCAAAGACTATGCT
TCGTTAAAGGAAGCTTAATATTATTGTAACTAATCAGCTGAATGTGTTGGTGTTACATAT
GTAAAAGATTTTACTTTCAATCATTTTGGTTAACTTTTTAATAAAATAAATAGCAAAGTA
TTGAAATTGATGCAGGTGATAACTCTGTAGGTTATATTTAAGGATATGGTTACTAACTTA
GAAAGGGTTCTTTGAAAGCTAGCTCTGATGTTATTTCTTGGGTTAAATAGACTGGTCTTG
CTAATAACCCTGCTACTACTCCCTCATCACCCTCATCCTCATCATCATCTAGTTCTAGCT
CTAACTCTTCATCCTCTAGTTCATCAAGCTCAAGCTCCTCATCTAGTTCATCTAGCTCAT
CATCAAGTTCAAGCTCAAGCTCCTCATCTAGCTCATCATCAAGTTCAAGCTCATCAGGAT
CAAGTGGAAGCAGTTCTAATACTTCTTCTGGATCATCAGGATCAAGTGGTTCATCTGGAT
CATCAGGATCAAGTGGTTCATCTGGATCATCAGGATCAAGTGGTTCATCAGGATCAAGTG
GTTCATCAGGATCAAGTGGTTCATCTGGATCATCAGGATCAAGTGGTTCATCTGGTTCAT
CAGGATCAAGTGGTTCATCTGGTTCATCAGGATCAAGTGGTTCATCTGGATCAAGTGGTT
CATCTGGTTCATCAGGATCAAGTGGTTCATCTGGTTCATCAGGATCAAGTGGAAACAATT
AAGGTACTCCATCTTCTACATAACCTACTGAATAAGCAGCTGGATGTCCTATTCTTTATA
CTGAGTGCTACTATAGTGGTAATTCAGTATCAGTTTGTTCTAACAATCCTGACTTTAACT
GGCGTCCTTACAAATCTCTCAAAATCCCAGATGGTTAATATGTAGTAATTTATGAAGAAG
ATAATTACAAGGGTGAAAAATACTACTACGATTAGAGCATTCCTTGTTCTGATGATGTTT
AATTATTCCTTTTTGAAAACAAGAAAAGCTTTGATGAATAAGAAAGTGCTACTACCAGCC
ATAAAAAGCACCACAAAAAGAATCACCATAAGCTTAAAAAGAATTCAGATTGA