Identifiers and Description

Gene Model Identifier

TTHERM_00038890

Standard Name

CCF10 (C-terminal Crystallin Fold )

Aliases

PreTt14524 | 2.m02273 | 3825.m02893

Description

C-terminal crystallin fold protein; domain structure suggests localization in dense core granules; contains signal peptide and tandem 80-residue motif with 6 cysteines conserved among CCF9, CCF10, CCF11, and CCF12

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00038890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05799.11.0003503620230312e-57hypothetical protein (772 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7

Sequences

>TTHERM_00038890(coding)
ATGAAAAATCTAAGTGTATTATTGATTCTAGGATTAGCTATAAGCTAAGTTTATTGCGGC
TGTGCTTATACTACTGGATTTGGCGCTTTCAGCGGGTACTGTTACAATGATTGTAAGGAT
TATGCTACTTTATCTGAAGCTATGGCTGCATGTGACAGTTCTACTAGTTGTGGTGGAGTT
ACATTTAGTTAAAGATAATATGGTGGTGGTGCTTCAACTAATGCTATAGGTAATGGATAT
GGTTATCAACTTAGAGCTTCCTATTCAGGTGGTCCTTCTACTGTCAGAGAAACCACATGG
TTCAAATCTACTTGCCCTGATCCTCATACTCCTTTCGAACCCTGCGATTATGCATAAGGT
TAAGGTGTTTTCTTAGCAGATTGTGTTTAAGGTTGTAAGGACTTCTCTAATTTGAATGAC
GCCCTTAATGCTTGCAGAGCTGATCCTTCATGTGGTGGTGTAACTTTCTCCAGAAAGGAG
ATTGGTGGCCCTGCTGCTACTAATGCATTTGATGGTGTTTGGGGTTTCTAGTTAAGAGCT
GGATCTGTATTTGGTGTTTCATAGTGTGGTGAAAGTTCATATGTTAAATAAAAATGTCCA
GTTTCTTAAGTCTAAGGAACTTACTGCAACTATTCAAAGCAATCTTATCAAAACTTTGCT
AATTTAATCCAAAGGGATATTTAATATACCACCGAATAGTCAGCTTTAACTGCATGTGAT
TCAACTCCTGATTGTACTGGTGTTGTTTTAAACTAAGGATCATTCTATTTGGCTACTGGT
ACCTCATCTCCTAGCACTACTAACAGTGTTGCATACACTAAAGGAACATGCAATGTCATC
ACTTATCCTATTCTCTTTAGTGGATGCAATTTCACTGGAAGCTAAGTCAATCTCACCTCA
GATCTTGCTTAAATTGACTTAAGATAATACAAGAGTTTGTATATTCCTGCTGGTAAGTCA
GTCAGATTCTACACCAAATCAAACTTCAAGGGAAACAATAATGTTTACACAACTTCTGTC
TACTGTTAAAGTTAAAGCTTTGGCTCTGTCTTTATTTAAAAGGCTTACTCTTAAGATTTT
TCTTTCGAAACTTCAATTTAAGTAAGAGATCTCAAAGTTAATAGAAAGCTTAAGCCTAAT
TAAAACTGA


>TTHERM_00038890(protein)
MKNLSVLLILGLAISQVYCGCAYTTGFGAFSGYCYNDCKDYATLSEAMAACDSSTSCGGV
TFSQRQYGGGASTNAIGNGYGYQLRASYSGGPSTVRETTWFKSTCPDPHTPFEPCDYAQG
QGVFLADCVQGCKDFSNLNDALNACRADPSCGGVTFSRKEIGGPAATNAFDGVWGFQLRA
GSVFGVSQCGESSYVKQKCPVSQVQGTYCNYSKQSYQNFANLIQRDIQYTTEQSALTACD
STPDCTGVVLNQGSFYLATGTSSPSTTNSVAYTKGTCNVITYPILFSGCNFTGSQVNLTS
DLAQIDLRQYKSLYIPAGKSVRFYTKSNFKGNNNVYTTSVYCQSQSFGSVFIQKAYSQDF
SFETSIQVRDLKVNRKLKPNQN


>TTHERM_00038890(gene)
ATGAAAAATCTAAGTGTATTATTGATTCTAGGATTAGCTATAAGCTAAGTTTATTGCGGC
TGTGCTTATACTACTGGATTTGGCGCTTTCAGCGGGTACTGTTACAATGATTGTAAGGAT
TATGCTACTTTATCTGAAGCTATGGCTGCATGTGACAGTTCTACTAGTTGTGGTGGAGTT
ACATTTAGTTAAAGATAATATGGTGGTGGTGCTTCAACTAATGCTATAGGTAATGGATAT
GGTTATCAACTTAGAGCTTCCTATTCAGGTGGTCCTTCTACTGTCAGAGAAACCACATGG
TTCAAATCTACTTGCCCTGATCCTCATACTCCTTTCGAACCCTGCGATTATGCATAAGGT
TAAGGTGTTTTCTTAGCAGATTGTGTTTAAGGTTGTAAGGACTTCTCTAATTTGAATGAC
GCCCTTAATGCTTGCAGAGCTGATCCTTCATGTGGTGGTGTAACTTTCTCCAGAAAGGAG
ATTGGTGGCCCTGCTGCTACTAATGCATTTGATGGTGTTTGGGGTTTCTAGTTAAGAGCT
GGATCTGTATTTGGTGTTTCATAGTGTGGTGAAAGTTCATATGTTAAATAAAAATGTCCA
GTTTCTTAAGTCTAAGGAACTTACTGCAACTATTCAAAGCAATCTTATCAAAACTTTGCT
AATTTAATCCAAAGGGATATTTAATATACCACCGAATAGTCAGCTTTAACTGCATGTGAT
TCAACTCCTGATTGTACTGGTGTTGTTTTAAACTAAGGATCATTCTATTTGGCTACTGGT
ACCTCATCTCCTAGCACTACTAACAGTGTTGCATACACTAAAGGAACATGCAATGTCATC
ACTTATCCTATTCTCTTTAGTGGATGCAATTTCACTGGAAGCTAAGTCAATCTCACCTCA
GATCTTGCTTAAATTGACTTAAGATAATACAAGAGTTTGTATATTCCTGCTGGTAAGTCA
GTCAGATTCTACACCAAATCAAACTTCAAGGGAAACAATAATGTTTACACAACTTCTGTC
TACTGTTAAAGTTAAAGCTTTGGCTCTGTCTTTATTTAAAAGGCTTACTCTTAAGATTTT
TCTTTCGAAACTTCAATTTAAGTAAGAGATCTCAAAGTTAATAGAAAGCTTAAGCCTAAT
TAAAACTGA