Identifiers and Description

Gene Model Identifier

TTHERM_00227220

Standard Name

CCD39 (coiled-coil domain protein 39)

Aliases

PreTt12532 | 19.m00324

Description

Localizes to ciliary axonemes; essential for assembly of inner dynein arms in humans (CCDC39)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08528 ) Whi5 like
  • ( PF02524 ) KID repeat
  • ( PF03789 ) ELK domain
  • ( PF01576 ) Myosin tail
  • ( PF02370 ) M protein repeat
  • ( PF05672 ) E-MAP-115 family
  • ( PF04778 ) LMP repeated region
  • ( PF08647 ) BRE1 E3 ubiquitin ligase
  • ( PF00769 ) Ezrin/radixin/moesin family
  • ( PF05377 ) Flagella accessory protein C (FlaC)
  • ( PF04325 ) Protein of unknown function (DUF465)
  • ( TIGR00288 ) conserved hypothetical protein TIGR00288
  • ( PF09006 ) Lung surfactant protein D coiled-coil
  • ( PF06034 ) Nucleopolyhedrovirus protein of unknown function
  • ( PF04871 ) Uso1 / p115 like vesicle

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00227220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_321190
Tetrahymena borealisEI9_05506.19.997093137033517e-262hypothetical protein (963 aa)
OxytrichaContig20021.0.g849.997093137033517e-262Afadin- and alpha -actinin-Bin
ding

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00227220(coding)
ATGGATTAGGGAGAATTTATTCAGGATGATAATGATCAGGATTATGATCAATAGGAGGGA
GATGATGAAAACAATGATTATATGGAAGATCCTTAATAGGATAATAATTACAACTAAAAT
GGCGACAATTTAGATGATCAAGGTCAAGATGATGATGGTGGCTAGAACAACCTCTAGCAG
CCATCAGTTCCTCCTGAAGACGATGAGGATGACGATGATGATTTCCCTGAATATGCAAAT
GAACAAAATAAAAGACTTAATGAAATCATCAAAAAGAAGAGAAAGCTTATTAAGGATATT
TCTGCCAAAATTGAAGAGAAGTCTGACCGTACCAAAGTTTTACAAGAGCACTTGAAAAAT
GTTGAGCAAGAGCTTTTACATACATAAGCATTGATCGATGCTAAAAACAAAGAAATTGAA
ACTGAAGATCACATGAAATAAATTGCTGAACGTTAAAGTGGTCGTATTCAGAGCGAATTG
AAAATTCTTGAAAAAAGATCAATTGAGTAGCAAGAAAAACTAAATGACGTATAAAACCAA
ATCTTCAGGGGAAATGAAAAAATGGATTAATACAAGTTAGAAATGAATTGGAATCAAGAA
GAATTAGAGTAGTGGGCTCTTGCTGCTCGTTAAAAGGAAGAAGATAACTTAACCCTTGAA
AAATATAAACGTGCTGATGAAGTTAAAATCAAGGAATTGAATCTTGCCATTGAAAAACTT
ACTGCCGAAGTTGGAAGAAAATAAAACGAATTAGAAAAGGAAATTACTGAAACTTAAGCT
GCTCAAATTGAATTAGACAAGACTGCTGAAGAATTCAAGAGATAACATGAGGAGAGACAT
AAATTATTTTTGTAATGGCAAGAAGTAACAGAAATTATCTCAAAGAGAGATCTTGCTATT
CGTGAGGAAGGTGAAAATTTCGCTCGTATTAAGATTGAAATCAAGTCAAATAAAGACGCT
TTAGAAGAAAGAAAGCGTATTTTGAAGGAAGCCAAAGAAGAAAACAAACGTATCTAAATG
GCTAATGAACTTATGGAAAGACAAAATATCTAACAAATATCTGATAACAAACACATTGAA
GAATAATTGGCAGAGAAGAAAGCTGATGTTGAAATCCTTAAAAACTAAGTTAGTGCTTTT
GCAAGTGATTTGTCTTCCAAAAAGAACAGAATTGCTATTTTAAGTTAAGAATTGCTAGCT
AAGAAGCAAAGACTTAATGCTGCTTAAAAGAAGTATCAAGCTCACTAAGTCAAGCTAAAA
AATGAAGAGATTATGGCCAAATAATATGAAAACGACAGATCCTATGCTGAAGAAAAATAT
AGAAAAAATGAAAAGGAAAAGAAAGAACTTGAGAAGGAAATCAGAACTTAAAAGGAAAAT
CTGTTTAAGCACACCTAAGAGTTATTCAAACACAGAGAAAGAGAAGCTAACCTCTATGGT
GAAATCCAAGGAAACATGGCTGCATGCAGAAACCTTTAATCTCATATTACTAAATTAAAT
CAAGAATTTTAGCGTCAATAAGAACTTTTGTATAATGCTGAGTATCAAATCTAACTCATG
GAAAGAAGAGTAGCTCGTGCAAAGGGTGAAAGAACTTTAGAAGAAAAGAAGGATTTGGAA
AATGAAATTATGAATGCTGAAAGGGAGCTTGGAGGAGTCACTGGACAAAATAAAGAGCTG
ATTGAATCTCTCAAGAATTTAGATGATGAAATTAGAACTGTGAAGAAAAAACTTGCTTAC
GTTGAAGAAGAAAATACAAAGTATTCCAGTTTGATTGAAGAACTCATCCTTGAAAACGAT
ATGACTTACTAAGATTTGAATAAGATCATTAAATAAAAAGAAGAAGTTCTCGTTTAACAT
GATACAATGAAGCTAGAAATTAAAAAGATCAATGAAAGTTTGAATGGAGCTACAGAAAAA
GTCTTCAATCTTGAAAACTAAATTTACTAATTAGAAATGAGTATGCAAGAAAGAGAAAAG
GAAATTGAAGTCCATAAGGATGTCTTAATGACCGAACATAAAGCAGCAGAAGAAGAAAGA
CACAAAATTGCAGTAGAATTGGCTGAAAGAAAAAACAAAGTCAAGAACTTAAAGATTAAG
TACGAATCTCTAGTTCAAAAAAATAAGGCTTCAAATGGTGAAGTTGAATCTGTACATGAG
CACTCTCAAGCTTACTATGTTATTAAAGCAGCCCAAGAAAGAGAAGAATTACAAAGAAAG
GGTGATGAACTCAATGCCAAAATATTGAAGAATGAAAAAGAATTAAAGGCATTAGATAAC
ACACTCAACCATTTAAAAAATAGAAATTCTAATTACAGAGACAAATTCCTTAACAAGGGA
GTTACTACTTAACATAGAGAAGAAGCTGAAGGATTAGAAGAACAATGTAGAGCAGCTTCA
TAAAATTTATTTAAAAAGAGAGATGAGCTACAAAAGCTCTAAAAAGAGTAAGAAGAAGAC
ACAAGAAGATATACTGAAATAAAAAATAAATTGGAAAGATTATATGAATAGCATCAAAGC
TTAGATCAAGAAATCTCTAAGTACCAAAAAGATATAGATCAATAAGGAGATAAACTTTAA
AGAGCTTAGAATTCTTTACAAAGAAATTATTAGTTGGCAGTAAATAAAAACTAAAATTTT
ATTAATCCAAAGAATCCTCACATGATTTAAGTCAAGCTTGACAATTAAAATAATCTCTAC
AAAACTTTGCTCTAAGGGCTTTACTCTTTACAACAAGATATTCCCGAGCTTAGTAGCGTT
GTTGATGAAATATTAAAGGAATAAAGAATATAAAACAATAAGGCTCCTTCTTCGATAGAT
ATAAATTCAAAGCGCTCTTCACAGTCAGGTCGCTCTCAAAGATCATAAAGATCAAACATT
AGTAATTAATGA


>TTHERM_00227220(protein)
MDQGEFIQDDNDQDYDQQEGDDENNDYMEDPQQDNNYNQNGDNLDDQGQDDDGGQNNLQQ
PSVPPEDDEDDDDDFPEYANEQNKRLNEIIKKKRKLIKDISAKIEEKSDRTKVLQEHLKN
VEQELLHTQALIDAKNKEIETEDHMKQIAERQSGRIQSELKILEKRSIEQQEKLNDVQNQ
IFRGNEKMDQYKLEMNWNQEELEQWALAARQKEEDNLTLEKYKRADEVKIKELNLAIEKL
TAEVGRKQNELEKEITETQAAQIELDKTAEEFKRQHEERHKLFLQWQEVTEIISKRDLAI
REEGENFARIKIEIKSNKDALEERKRILKEAKEENKRIQMANELMERQNIQQISDNKHIE
EQLAEKKADVEILKNQVSAFASDLSSKKNRIAILSQELLAKKQRLNAAQKKYQAHQVKLK
NEEIMAKQYENDRSYAEEKYRKNEKEKKELEKEIRTQKENLFKHTQELFKHREREANLYG
EIQGNMAACRNLQSHITKLNQEFQRQQELLYNAEYQIQLMERRVARAKGERTLEEKKDLE
NEIMNAERELGGVTGQNKELIESLKNLDDEIRTVKKKLAYVEEENTKYSSLIEELILEND
MTYQDLNKIIKQKEEVLVQHDTMKLEIKKINESLNGATEKVFNLENQIYQLEMSMQEREK
EIEVHKDVLMTEHKAAEEERHKIAVELAERKNKVKNLKIKYESLVQKNKASNGEVESVHE
HSQAYYVIKAAQEREELQRKGDELNAKILKNEKELKALDNTLNHLKNRNSNYRDKFLNKG
VTTQHREEAEGLEEQCRAASQNLFKKRDELQKLQKEQEEDTRRYTEIKNKLERLYEQHQS
LDQEISKYQKDIDQQGDKLQRAQNSLQRNYQLAVNKNQNFINPKNPHMIQVKLDNQNNLY
KTLLQGLYSLQQDIPELSSVVDEILKEQRIQNNKAPSSIDINSKRSSQSGRSQRSQRSNI
SNQ


>TTHERM_00227220(gene)
ATGGATTAGGGAGAATTTATTCAGGATGATAATGATCAGGATTATGATCAATAGGAGGGA
GATGATGAAAACAATGATTATATGGAAGATCCTTAATAGGATAATAATTACAACTAAAAT
GGCGACAATTTAGATGATCAAGGTCAAGATGATGATGGTGGCTAGAACAACCTCTAGCAG
CCATCAGTTCCTCCTGAAGACGATGAGGATGACGATGATGATTTCCCTGAATATGCAAAT
GAACAAAATAAAAGACTTAATGAAATCGTAATTAATTAAATTCTGATTATTTGGCAAGCA
AGCTCAGCCATATTAAAGCTAAAACAGCCATCCTTGCAATATATCTTGCATATTTGATTG
AATTAATTTGGATATTTATTTCATGTTTTATAACATAAAAATAGATCAAAAAGAAGAGAA
AGCTTATTAAGGATATTTCTGCCAAAATTGAAGAGAAGTCTGACCGTACCAAAGTTTTAC
AAGAGCACTTGAAAAATGTTGAGCAAGAGCTTTTACATACATAAGCATTGGTAAATAATT
AAATAGATTATTAAAATTAAAAATATAACAATTCAGCGAGCAAGAAATAAAAGAATAACA
AAGGGAAATAAATAAATAATCAATAATATTCAAAATAGAATAAGGATTAAAATGTTGAAT
GATGAAATTTAGTTGCTGATTCTTTAATATTTTCAATTTATGTTTTGATTAGATAGTGGT
AATTAAATTATACTTTATATTATTGATAGATCGATGCTAAAAACAAAGAAATTGAAACTG
AAGATCACATGAAATAAATTGCTGAACGTTAAAGTGGTCGTATTCAGAGCGAATTGAAAA
TTCTTGAAAAAAGGTAAACTATTTTGCTAATAAAATTTTTAGATTGTAATTTTGCTCAAT
AATGGATGAGAAATCTGATTATTATCATTGATTATTGTTGTTGTCTATCCTCTATTGATT
GCTTTTTAAAAAGCTATTTGAAATTTATAAATTTAATTTTGATCATCCCCTTTTTAAAAA
TAATCCTTTGCATAAACTAATAATTAATTAATTATTATTTTAATTAAATTTACGGTTACC
AGATCAATTGAGTAGCAAGAAAAACTAAATGACGTATAAAACCAAATCTTCAGGGGAAAT
GAAAAAATGGATTAATACAAGTTAGAAATGAATTGGAATCAAGAAGAATTAGAGTAGTGG
GCTCTTGCTGCTCGTTAAAAGGAAGAAGATAACTTAACCCTTGAAAAATATAAACGTGCT
GATGAAGTTAAAATCAAGGAATTGAATCTTGCCATTGAAAAACTTACTGTAAGTTAAATT
ATAAATATAAAATAATTATTTATAAAAGCAGATTTTTTGATATTTATTAAAAATGAACAA
ATAAATGAAAATTAAATATTTTAAACAAGGCCGAAGTTGGAAGAAAATAAAACGAATTAG
AAAAGGAAATTACTGAAACTTAAGCTGCTCAAATTGAATTAGACAAGACTGCTGAAGAAT
TCAAGAGATAACATGAGGAGAGACATAAATTATTTTTGTAATGGCAAGAAGTAACAGAAA
TTATCTCAAAGAGAGATCTTGCTATTCGTGAGGAAGGTGAAAATTTCGCTCGTATTAAGA
TTGAAATCAAGTCAAATAAAGACGCTTTAGAAGAAAGAAAGCGTATTTTGAAGGAAGCCA
AAGAAGAAAACAAACGTATCTAAATGGCTAATGAACTTATGGAAAGACAAAATATCTAAC
AAATATCTGATAACAAACACATTGAAGAATAATTGGCAGAGAAGAAAGCTGATGTTGAAA
TCCTTAAAAACTAAGTTAGTGCTTTTGCAAGTGATTTGTCTTCCAAAAAGAACAGAATTG
CTATTTTAAGTTAAGAATTGCTAGCTAAGAAGCAAAGACTTAATGCTGCTTAAAAGAAGT
ATCAAGCTCACTAAGTCAAGCTAAAAAATGAAGAGATTATGGCCAAATAATATGAAAACG
ACAGATCCTATGCTGAAGAAAAATATAGAAAAAATGAAAAGGAAAAGAAAGAACTTGAGA
AGGAAATCAGAACTTAAAAGGAAAATCTGTTTAAGCACACCTAAGAGTTATTCAAACACA
GAGAAAGAGAAGCTAACCTCTATGGTGAAATCCAAGGAAACATGGCTGCATGCAGAAACC
TTTAATCTCATATTACTAAATTAAATCAAGAATTTTAGCGTCAATAAGAACTTTTGTATA
ATGCTGAGTATCAAATCTAACTCATGGAAAGAAGAGTAGCTCGTGCAAAGGGTATTCAAT
TTATTTCTTTATTTTTTTATTTTCAAAATTATCTTGAAAATATAATGGTTATTTTATCTG
AAAATTAGGTGAAAGAACTTTAGAAGAAAAGAAGGATTTGGAAAATGAAATTATGAATGC
TGAAAGGGAGCTTGGAGGAGTCACTGGACAAAATAAAGAGCTGATTGAATCTCTCAAGAA
TTTAGATGATGAAATTAGAACTGTGAAGAAAAAAGTAATTCAAATTAATCATTGATTTTA
TGAATTAGTTAAATGTTTTTTTTGATTTTTTTCAAATAAGCTTGCTTACGTTGAAGAAGA
AAATACAAAGTATTCCAGTTTGATTGAAGAACTCATCCTTGAAAACGATATGACTTACTA
AGATTTGAATAAGATCATTAAATAAAAAGAAGAAGTTCTCGTTTAACATGATACAATGAA
GCTAGAAATTAAAAAGATCAATGAAAGTTTGAATGGAGCTACAGAAAAAGTCTTCAATCT
TGAAAACTAAATTTACTAATTAGAAATGAGGTTGATAGATAATATTTATTATTAAGCATC
ATCATAAAAATATTTTTATAATAAAATAGTATGCAAGAAAGAGAAAAGGAAATTGAAGTC
CATAAGGATGTCTTAATGACCGAACATAAAGCAGCAGAAGAAGAAAGACACAAAATTGCA
GTAGAATTGGCTGAAAGAAAAAACAAAGTCAAGAACTTAAAGATTAAGTACGAATCTCTA
GTTCAAAAAAATAAGGCTTCAAATGGTGAAGTTGAATCTGTACATGAGCACTCTCAAGCT
TACTATGTTATTAAAGCAGCCCAAGAAAGAGAAGAATTACAAAGAAAGGGTGATGAACTC
AATGGTAATTTAAACTATTTTATAACAAAAAATGTTAATTGAAATAAATTTAATTAATTA
AAATAGCCAAAATATTGAAGAATGAAAAAGAATTAAAGGCATTAGATAACACACTCAACC
ATTTAAAAAATAGAAATTCTAATTACAGAGACAAATTCCTTAACAAGGTAATGAATCAAA
TCAAAATGATAATTAGAGCAAGATAACATTTAACATAGAAATTATTTAAAATATTCAAAA
AAACAAAGAAATTATTCAAAAATAAAATAAAATTTCTTGCTTTTAATCTATTTTGTTTGA
TTAATAAAATTTAAAAATAAATAAATTTAAATTTTAAAGTTGATAAAAATAATGAATATT
GTTTATTTTAGGGAGTTACTACTTAACATAGAGAAGAAGCTGAAGGATTAGAAGAACAAT
GTAGAGCAGCTTCATAAAATTTATTTAAAAAGAGAGATGAGCTACAAAAGCTCTAAAAAG
AGTAAGAAGAAGACACAAGAAGATATACTGAAATAAAAAATAAAGTAAATTATTTTTTTC
ATTTGGAATTTATTTTAATTTTATCTTACAAACAAACAAAATAACAAAAAAAAATATCTT
TCTTATTAATTAATAGTTGGAAAGATTATATGAATAGCATCAAAGCTTAGATCAAGAAAT
CTCTAAGTACCAAAAAGATATAGATCAATAAGGAGATAAACTTTAAAGAGCTTAGAATTC
TTTACAAAGAAATTATTAGTTGGCAGTAAATAAAAACTAAAATTTTATTAATCCAAAGAA
TCCTCACATGATTTAAGTCAAGCTTGACAATTAAAATAATCTCTACAAAACTTTGCTCTA
AGGGCTTTAGTAATTTTTGCATTTAAAATTTAATTTATTGTTATATATTTTAAATACACT
TTGTTTTGTTTTGAAGAAAAATAAATTAATTTTTATTTTAAATGAATGTAGCTCTTTACA
ACAAGATATTCCCGAGCTTAGTAGCGTTGTTGATGAAATATTAAAGGAATAAAGAATATA
AAACAATAAGGCTCCTTCTTCGATAGATATAAATTCAAAGCGCTCTTCACAGTCAGGTCG
CTCTCAAAGATCATAAAGATCAAGTAATTTAAATTGATGATTTGTGTAATATTTTCTTAT
TTTATATATTTAATAATAATAAAAGACATTAGTAATTAATGA