Identifiers and Description

Gene Model Identifier

TTHERM_00196650

Standard Name

CCCP1 (Cortical-expressing Calpain-family Cysteine Protease 1)

Aliases

PreTt06850 | 16.m00506

Description

Calpain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • calcium-dependent cysteine-type endopeptidase activity (IEA) | GO:0004198

Biological Process

Domains

  • ( PF02422 ) Keratin
  • ( PF00648 ) Calpain family cysteine protease
  • ( PF08293 ) Mitochondrial ribosomal subunit S27
  • ( TIGR02145 ) Fibrobacter succinogenes major paralogous domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00196650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03834.19.997093137033517e-262calpain family cysteine protea
se containing protein (698 aa)
OxytrichaContig18567.0.g977.999011707514803e-86Calpain family cysteine protea
se
WormBaseWBGene000005462.9993743585281133e-40locus:clp-6 status:Partially
_confirmed UniProt:Q9N4B2
protein_id:CCD72595.2
Stentor CoeruleusSteCoe_269724.4737793061811207e-38

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00196650(coding)
ATGTTTGGCCAAAACTTTAACATTGCTGATTTAAATTCCAAGTTCGGAATGTCAGCTTAG
CCTCCTAGTTAACCTAGAAGTGGATTTGGAGCTAATAGCTCTTAGTTATCAAATCCTTTA
ACTGCAAACACTCCTTAAAGCAGAGGTAGAGATGATACTGCATCTAGCACTCACAATATG
TAAGACTTCCGTATGAATTTTAACATTGACTCTATATCAGCTCCCAGATAAGGCAATTTC
AAAGATTCTCTATCAAATCCTATGTCATTTGGTGGCGGATTTGGTGGCTCAAGCGGATTT
GGAGGCTAAGGCGGATTTGGTGGCTCTAGCGGATTCGGTGGTGGCTATGGAAACTATGGT
GGAGGTTTCGGAAGTAATACAGGAGGATTTGGAGCTCCAAGCTCTAACTTAGGTGGCTAA
TATGGTTTGAACAAACCTTCTTAACCTTCTTCTTATAACTATCAACCTACTTCTGCTCCT
ATTGGTAACCAAAATGTTTACTTTGCAAACAAAAATACAAAAATGGCTGATTAATTTGTT
GCTCCTCCTCCTTAAAAACCTACTCCCTCCTTTGACACAAACTAGCATAAATAGATTGAA
AACATTATGAAGCAACATAGTGATGTCGATAAAGGCGATATGATGGACAAAGCTCACTTG
GGTAAAGTTATTTACAGTGCTGCATTAAGTTCTTCATCTACAAGCTAGAAATATGACAAG
CTTCTTGCAGACTTAAAGAGAACCAACTCCAAGTTCACTGATTCTGATTTCCCACCTGAA
AAGAGTAGTCTTGCCACTCCTGACAAATTAGGTTCTTACAGAGATATTGTTGCTTGGAAA
AGAGCATCTGAGATATTTAAAAAACCTTGCCTTTACGAAGGTGCAATTGAACCAAATGAT
ATTCTTCAAGGTAATATGGGTGATTGCTATTTACTTTCCACCCTTGCTGCTATTGCTGAA
AACCCTGATAGAATCAGAAGGATTTTCCTTACTTAAAACTATAACGAATAAGGTATTTAT
GCTTTAAACATTGTTTGGAGAGGTGCCAATCGTGAAGTTATTTTAGATGACTACTTCCCA
GTCGATAAGAAAAATGAGCCTTATTTCTTGAAATCTAAAAATAATGAACTTTGGGTCGTT
CTTTTAGAAAAAGCTTGGGCTAAGTTACATAGAAATTATGATAGACTTGATGGTTAGTTA
ACAAAGGAAACTCTCCATGATTTCACTGGAGCTCCTGTTAGAAGTTATAGAACCAATAAA
GATTAACAACAATTATGGTAAAAGATGGTTGATGCTGATAAGAAAAATTTTATTATGACT
ACTGGTACAGAAGGTGAAGATGTTGGTGCTGGTGATCCTTTAAGAAAATTCGGTCTTGTT
TCTGGTCATGCCTACACACTTATTGGAGCTAATGAAGTCAGACTTAACAATGGTCAAACT
GTTTAATTAGTCTAAGTCAGAAATCCTTGGGGTGAATTTGAATGGTCTGGCAAATGGAGT
GATAAAGATAGTTTGTGGAATAACGTTTCTTAATCAGAAAAGAATAGAATTGGCTACAGT
GTTGAAGATGATGGTACTTTCTTCCTTGAATACAGAGATATGCTCGAATATTTTGATGGT
GTCTAAATATGTTATTACCATGATGGATTCGTTTATTCAGGATAAGAATTTAGAAGTTCT
TCTACTGAATCAAAATACTTTGAAATTAAGATTCCTTAAACTGGCAATTATTATTTCAAT
GTAAGCTAAATTTCAATTAGAATATTTGATGAAGATTATCAAGATAACCCTAATTCTCAT
TATTCAGATACTAAATTCTGTATTGCTGACTAAAGTGGTAAGATTCTTTAAGGTTACTAT
GGTAAAAAGCGTGACCTTTATTCATGCAAATACATCGATAATCCCTTCTAGTTCTAAGCT
GGAACTTATCAAGTTTTTGTAAGAGTAAATTGGTAGAAAGGTGCCACTCACAGCTTTGGT
CTAGGTGCTTATGGTCCTGGTAAAATCGAAATTAAGGAAATTAACAAATCTCAAGCTGGT
AACTTATCTAATGCTGTTGCTCCTTGGGAACAAAATCGTTATCCTTAATTCGAAATCGAA
CAAATTGCCGTCATTTGA


>TTHERM_00196650(protein)
MFGQNFNIADLNSKFGMSAQPPSQPRSGFGANSSQLSNPLTANTPQSRGRDDTASSTHNM
QDFRMNFNIDSISAPRQGNFKDSLSNPMSFGGGFGGSSGFGGQGGFGGSSGFGGGYGNYG
GGFGSNTGGFGAPSSNLGGQYGLNKPSQPSSYNYQPTSAPIGNQNVYFANKNTKMADQFV
APPPQKPTPSFDTNQHKQIENIMKQHSDVDKGDMMDKAHLGKVIYSAALSSSSTSQKYDK
LLADLKRTNSKFTDSDFPPEKSSLATPDKLGSYRDIVAWKRASEIFKKPCLYEGAIEPND
ILQGNMGDCYLLSTLAAIAENPDRIRRIFLTQNYNEQGIYALNIVWRGANREVILDDYFP
VDKKNEPYFLKSKNNELWVVLLEKAWAKLHRNYDRLDGQLTKETLHDFTGAPVRSYRTNK
DQQQLWQKMVDADKKNFIMTTGTEGEDVGAGDPLRKFGLVSGHAYTLIGANEVRLNNGQT
VQLVQVRNPWGEFEWSGKWSDKDSLWNNVSQSEKNRIGYSVEDDGTFFLEYRDMLEYFDG
VQICYYHDGFVYSGQEFRSSSTESKYFEIKIPQTGNYYFNVSQISIRIFDEDYQDNPNSH
YSDTKFCIADQSGKILQGYYGKKRDLYSCKYIDNPFQFQAGTYQVFVRVNWQKGATHSFG
LGAYGPGKIEIKEINKSQAGNLSNAVAPWEQNRYPQFEIEQIAVI


>TTHERM_00196650(gene)
ATGTTTGGCCAAAACTTTAACATTGCTGATTTAAATTCCAAGTTCGGAATGTCAGCTTAG
CCTCCTAGTTAACCTAGAAGTGGATTTGGAGCTAATAGCTCTTAGTTATCAAATCCTTTA
ACTGCAAACACTCCTTAAAGCAGAGGTAGAGATGATACTGCATCTAGCACTCACAATATG
TAAGACTTCCGTATGAATTTTAACATTGACTCTATATCAGCTCCCAGATAAGGCAATTTC
AAAGATTCTCTATCAAATCCTATGTCATTTGGTGGCGGATTTGGTGGCTCAAGCGGATTT
GGAGGCTAAGGCGGATTTGGTGGCTCTAGCGGATTCGGTGGTGGCTATGGAAACTATGGT
GGAGGTTTCGGAAGTAATACAGGAGGATTTGGAGCTCCAAGCTCTAACTTAGGTGGCTAA
TATGGTTTGAACAAACCTTCTTAACCTTCTTCTTATAACTATCAACCTACTTCTGCTCCT
ATTGGTAACCAAAATGTTTACTTTGCAAACAAAAATACAAAAATGGCTGATTAATTTGTT
GCTCCTCCTCCTTAAAAACCTACTCCCTCCTTTGACACAAACTAGCATAAATAGATTGAA
AACATTATGAAGCAACATAGTGATGTCGATAAAGGCGATATGATGGACAAAGCTCACTTG
GTAAATAAAATATAGCATTTTTTAAAAATTGTTAAATAGATAGATTCAAAAAGATTGCAA
TAAAATAAATAAATTTTATCTAATGAAAGATAATCAATCAAGGAATCTATTTATTCTATT
GATTTTATTTATTTATTTACAAGACTTTTCTTATTTTTGGTGAAGGTTTTTTTCCCTAAT
CTAATTGTTAATTACTGTGAAAATCATTAATTAATTAACTCAATCAAAAATATTAGAAAC
CAAAACGAAGCAAATCTTTAAATAAATAAATAAATTATAAATAAACGTATATTAATTAAA
AACAAACTGATTAAATATTTCAATATTAATAGGGTAAAGTTATTTACAGTGCTGCATTAA
GTTCTTCATCTACAAGCTAGAAATATGACAAGCTTCTTGCAGACTTAAAGAGAACCAACT
CCAAGTTCACTGATTCTGATTTCCCACCTGAAAAGAGTAGTCTTGCCACTCCTGACAAAT
TAGGTTCTTACAGAGATATTGTTGCTTGGAAAAGAGCATCTGAGATATTTAAAAAACCTT
GCCTTTACGAAGGTGCAATTGAACCAAATGATATTCTTCAAGGTAATATGGGTGATTGCT
ATTTACTTTCCACCCTTGCTGCTATTGCTGAAAACCCTGATAGAATCAGAAGGATTTTCC
TTACTTAAAACTATAACGAATAAGGTATTTATGCTTTAAACATTGTTTGGAGAGGTGCCA
ATCGTGAAGTTATTTTAGATGACTACTTCCCAGTCGATAAGAAAAATGAGCCTTATTTCT
TGAAATCTAAAAATAATGAACTTTGGGTCGTTCTTTTAGAAAAAGCTTGGGCTAAGTTAC
ATAGAAATTATGATAGACTTGATGGTTAGTTAACAAAGGAAACTCTCCATGATTTCACTG
GAGCTCCTGTTAGAAGTTATAGAACCAATAAAGATTAACAACAATTATGGTAAAAGATGG
TTGATGCTGATAAGAAAAATTTTATTATGACTACTGGTACAGAAGGTGAAGATGTTGGTG
CTGGTGATCCTTTAAGAAAATTCGGTCTTGTTTCTGGTCATGCCTACACACTTATTGGAG
CTAATGAAGTCAGACTTAACAATGGTCAAACTGTTTAATTAGTCTAAGTCAGAAATCCTT
GGGGTGAATTTGGTAAATTTCTTTTATATTAAAAAAATATTTTTTTAGAAGAGAAATCTT
GTTTACTTATTTATTTTTTTGGCTCTTTATTATATTTAACATAGAAAAGTTTATATTATC
TGATAAAAAAGCAAATTAATAGTAAATTTATTAGAAAAATAAGTTAAGATAGATTTCATT
TATATTTTAAGCGAATAGATATTTATTTAAATACTTATGTTTAGATAATTATTTAAAGTT
TGTCAAAAAAACAAAAGAGCATATCATTGTTTATAAAATTTATAATTAAATTTAAAGAAT
CAATAAAAATTTTATTTAAATAGCAGTTCAAATATAATATGTTTTTAATAATCAAATATT
TTATTTAAAGAATGGTCTGGCAAATGGAGTGATAAAGATAGTTTGTGGAATAACGTTTCT
TAATCAGAAAAGAATAGAATTGGCTACAGTGTTGAAGATGATGGTACTTTCTTCCTTGAA
TACAGAGATATGCTCGAATATTTTGATGGTGTCTAAATATGTTATTACCATGATGGATTC
GTTTATTCAGGATAAGAGTAAAAAATTAATTAAATATATTTTTTATTTATTTCTTACAAT
CCTTTCATTATCATAAATAATAAATTTTAGTTAATTTTTATTTTTATCAAAGTTATTTAT
ATGTTATTATTTTATAATAGATTTAGAAGTTCTTCTACTGAATCAAAATACTTTGAAATT
AAGATTCCTTAAACTGGCAATTATTATTTCAATGTAAGCTAAATTTCAATTAGAATATTT
GATGAAGATTATCAAGATAACCCTAATTCTCATTATTCAGATACTAAATTCTGTATTGCT
GACTAAAGTGGTAAGATTCTTTAAGGTTACTATGGTAAAAAGCGTGACCTTTATTCATGC
AAATACATCGATAATCCCTTCTAGTTCTAAGCTGGAACTTATCAAGTTTTTGTAAGAGTA
AATTGGTAGAAAGGTGCCACTCACAGCTTTGGTCTAGGTGCTTATGGTCCTGGTAAAATC
GAAATTAAGGAAATTAACAAATCTCAAGCTGGTAACTTATCTAATGCTGTTGCTCCTTGG
GAACAAAATCGTTATCCTTAATTCGAAATCGAACAAATTGCCGTCATTTGA