Identifiers and Description

Gene Model Identifier

TTHERM_00095540

Standard Name

CBF5 (Nucleolar protein CBF5)

Aliases

PreTt22853 | 7.m00302

Description

putative rRNA pseudouridine synthase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01472 ) PUA domain
  • ( PF00831 ) ribosomal protein L29
  • ( PF08068 ) DKCLD (NUC011) domain
  • ( TIGR00012 ) ribosomal protein L29
  • ( TIGR00451 ) uncharacterized domain 2
  • ( TIGR00431 ) tRNA pseudouridine synthase B
  • ( TIGR00425 ) rRNA pseudouridine synthase, putative
  • ( PF08660 ) Oligosaccharide biosynthesis protein Alg14 like
  • ( PF01509 ) TruB family pseudouridylate synthase (N

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00095540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_381510
WormBaseWBGene000104789.997093137033517e-262Putative H/ACA ribonucleoprote
in complex subunit 4 status:
Confirmed UniProt:O17919 p
rotein_id:CAB07244.1
Tetrahymena borealisEI9_00259.19.997093137033517e-262rRNA pseudouridine synthase, f
amily protein (426 aa)
DictyBaseDDB_G02819339.997093137033517e-262nola4 on chromosome: 3 positio
n 5161271 to 5163028
OxytrichaContig17910.0.g69.997093137033517e-262DKCLD (NUC011) domain
SGDYLR175W9.997093137033517e-262CBF5 Pseudouridine synthase ca
talytic subunit of box H/ACA s
mall nucleolar ribonucleoprote
in particles (snoRNPs), acts o
n both large and small rRNAs a
nd on snRNA U2; mutations in h
uman ortholog dyskerin cause t
he disorder dyskeratosis conge
nita

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00095540(coding)
ATGGGTAAAGATAAGAAGAAGCAAAGAAAGCAATCAAGCGAAGTTGCTGAAGTTGAAGAG
CAAGTCGTCGCTTAAGATTTTATTAAACCTTCCAAGGGAGGCGCTAAGTTGGATGCTAGC
CAATGGCCCTTATTATTAAAGAATTACGATAAGATGAACATCAGATCATCTCACTACACC
CCCATTCCTAACGGATCTAACCCCCTAGCTAGACCCATGGAAGAACATTTAAAATATGGT
GTTATGAATTTGGATAAGCCTTCTAACCCCTCTTCTCACGAAGTTGTCGCATGGGTTAAG
AAGTTGTTCGAAAATATCACTAAGATGGAAAAGACCGGTCACTCTGGTACCCTTGATCCT
AAGGTTACTGGTTGTTTGATCGTTTGTTTGAACCGTGCTACTAGATTGGTTAAGGCTCAA
TAGAGCGCTGGTAAGGAATACGTTGGTATTGTTAGACTCCACAACGATATTGAATCCGAA
CTCAAGCTCGCTAAGGCCCTCCAACAATTGACTGGTCCCCTTTTCCAAAAGCCCCCTCTT
ATTTCCGCTGTCAAGAGAGAATTGAGAGTTAGAACTATTTATGAATCTAAGTTAATTGAA
TACAATCCCGAAAAGAAGATGGGTATCATCTGGATGAGTTGCGAAGCTGGTACTTACGTT
AGAACCCTCTGTGTCCACTTAGGTCTCTTACTCGGTACTGGTGGTCATATGGAAGAACTT
AGAAGAGTTCGTTCTGGTATCCTCGACGAAAACTAATATCTCGTCACCATGCACGACGTC
AAGGACTCTATCTGGAGATATCAACACTTCAAGGATGAATCTTATCTCAGACGTGTTGTT
TTACCTCTTGAAGTTTTACTTACTAGTTTCCCTCGTATTGTCGTTAAGGATTCTACCGTT
AACTCTATCTGTTATGGTGCTAAGCTCATGCTCCCTGGTGTCCTCCGTTATGACAACAAC
ATTGAAAACGGTAAGGAAGTAGTTTTGATCACCACCAAGGGTGAAGCTATCGCTGTTGCT
GTTGCTTAAATGACCACCTCCGAACTCGCCACCTGCGATCACGGTATCGTCTGCAAGACC
AAGAGAGTTATTATGGACAGAGACCTCTATCCCAAGAGATGGGGTTTGGGTCCTAGAGCC
TTAAGAAAGAAAAACCTCATCAAGGAAGGTCTCTTAGATAAGCACGGAAAGCCCAACGAT
TAAACACCTAACGACTGGACTGTTTTCTACGTTAATGAAGAAAATAACAACATCCCCAAG
CCTGAAGAAAATTGA


>TTHERM_00095540(protein)
MGKDKKKQRKQSSEVAEVEEQVVAQDFIKPSKGGAKLDASQWPLLLKNYDKMNIRSSHYT
PIPNGSNPLARPMEEHLKYGVMNLDKPSNPSSHEVVAWVKKLFENITKMEKTGHSGTLDP
KVTGCLIVCLNRATRLVKAQQSAGKEYVGIVRLHNDIESELKLAKALQQLTGPLFQKPPL
ISAVKRELRVRTIYESKLIEYNPEKKMGIIWMSCEAGTYVRTLCVHLGLLLGTGGHMEEL
RRVRSGILDENQYLVTMHDVKDSIWRYQHFKDESYLRRVVLPLEVLLTSFPRIVVKDSTV
NSICYGAKLMLPGVLRYDNNIENGKEVVLITTKGEAIAVAVAQMTTSELATCDHGIVCKT
KRVIMDRDLYPKRWGLGPRALRKKNLIKEGLLDKHGKPNDQTPNDWTVFYVNEENNNIPK
PEEN


>TTHERM_00095540(gene)
ATGGGTAAAGATAAGAAGAAGCAAAGAAAGCAATCAAGCGAAGTTGCTGAAGTTGAAGAG
CAAGTCGTCGCTTAAGATTTTATTAAACCTTCCAAGGGAGGCGCTAAGTTGGATGCTAGC
CAATGGCCCTTATTATTAAAGAATTACGATAAGATGAACATCAGATCATCTCACTACACC
CCCATTCCTAACGGATCTAACCCCCTAGCTAGACCCATGGAAGAACATTTAAAATATGGT
GTTATGAATTTGGATAAGCCTTCTAACCCCTCTTCTCACGAAGTTGTCGCATGGGTTAAG
AAGTTGTTCGAAAATATCACTAAGATGGAAAAGACCGGTCACTCTGGTACCCTTGATCCT
AAGGTTACTGGTTGTTTGATCGTTTGTTTGAACCGTGCTACTAGATTGGTTAAGGCTCAA
TAGAGCGCTGGTAAGGAATACGTTGGTATTGTTAGACTCCACAACGATATTGAATCCGAA
CTCAAGCTCGCTAAGGCCCTCCAACAATTGACTGGTCCCCTTTTCCAAAAGCCCCCTCTT
ATTTCCGCTGTCAAGAGAGAATTGAGAGTTAGAACTATTTATGAATCTAAGTTAATTGAA
TACAATCCCGAAAAGAAGATGGGTATCATCTGGATGAGTTGCGAAGCTGGTACTTACGTT
AGAACCCTCTGTGTCCACTTAGGTCTCTTACTCGGTACTGGTGGTCATATGGAAGAACTT
AGAAGAGTTCGTTCTGGTATCCTCGACGAAAACTAATATCTCGTCACCATGCACGACGTC
AAGGACTCTATCTGGAGATATCAACACTTCAAGGATGAATCTTATCTCAGACGTGTTGTT
TTACCTCTTGAAGTTTTACTTACTAGTTTCCCTCGTATTGTCGTTAAGGATTCTACCGTT
AACTCTATCTGTTATGGTGCTAAGCTCATGCTCCCTGGTGTCCTCCGTTATGACAACAAC
ATTGAAAACGGTAAGGAAGTAGTTTTGATCACCACCAAGGGTGAAGCTATCGCTGTTGCT
GTTGCTTAAATGACCACCTCCGAACTCGCCACCTGCGATCACGGTATCGTCTGCAAGACC
AAGAGAGTTATTATGGACAGAGACCTCTATCCCAAGAGATGGGGTTTGGGTCCTAGAGCC
TTAAGAAAGAAAAACCTCATCAAGGAAGGTCTCTTAGATAAGCACGGAAAGCCCAACGAT
TAAACACCTAACGACTGGACTGTTTTCTACGTTAATGAAGAAAATAACAACATCCCCAAG
CCTGAAGAAAATTGA