Identifiers and Description

Gene Model Identifier

TTHERM_00471390

Standard Name

CAT14 (Conjugation-Associated Transporter 14)

Aliases

PreTt22549 | 56.m00253 | 3686.m00096

Description

Major facilitator superfamily protein; secondary membrane transporter protein; expressed during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF09051 ) Stannin cytoplasmic
  • ( PF00950 ) ABC 3 transport family
  • ( TIGR00900 ) H+ Antiporter protein
  • ( TIGR00880 ) Multidrug resistance protein
  • ( TIGR02210 ) rod shape-determining protein RodA
  • ( PF07690 ) transporter, major facilitator family
  • ( PF00083 ) transporter, major facilitator superfamily
  • ( PF00001 ) 7 transmembrane receptor (rhodopsin family)
  • ( TIGR03144 ) cytochrome c-type biogenesis protein CcsB
  • ( TIGR00881 ) phosphoglycerate transporter family protein
  • ( PF05978 ) Eukaryotic protein of unknown function
  • ( PF06027 ) Eukaryotic protein of unknown function

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 17.7%

TetraMine Data

TTHERM_00471390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11303.19.997093137033517e-262major facilitator superfamily
transporter protein (479 aa)
OxytrichaContig7446.0.g252.0003218023735366e-33Ion channel regulatory protein
UNC-93
DictyBaseDDB_G02917200.0000000000008001317446409227DDB_G0291720 on chromosome: 6
position 721305 to 722819
WormBaseWBGene000068220.000000100009565553302locus:unc-93 Putative potass
ium channel regulatory protein
unc-93 status:Partially_con
firmed UniProt:Q93380 prot
ein_id:CAB03760.3

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000291

Sequences

>TTHERM_00471390(coding)
ATGGAAAACACTGAAAAAGATCTAAAAATCGACTCAAAAGCCTACCTTAGAGGTAAACTG
AAAGTAGTTGTTTTATCATTTACTTTCATGGCTTTATTCTCCACTTTCAACTCTGCTTAG
AATCTTGTAGGAAGTCTTTACACCTCCTAAGGATATGATGACTTAGGTTTGATTTCTCTA
TTCGTTGTTTACATCGTATTTGCTTTCGCAAGTTTCTTTGCTAACTTCTTTATCAATAAA
TTCTCCTACAAGGTAATCTTCTTCTTCAGTAGTTTAGGTTACGTTGCTTTTGCAGCTTCT
GGTATTTGGGTTTGCTCATGTAAGAATGCCATACATGAAGGTGCATGCTCTAAGGGTGTA
ATTTACTTCATAGTCCTTGCCTCTGCAGCCCTTTGTGGTTTCAGTGCTTCTACAATTTGG
GTAGCATAAGGTGGCTATATTGATTCAATCAGTTAAGATTTCCCTAACAAAAAGGGTACT
CTTTTTGGTATTTTCTGGGCTATCAACTAAGGTAGTTAAATTGTTGGTAATTTGATGGGT
ATGTTCATTCTTAACTATCTTGATAATCTATATTATTTCTTGATTATGACATTCCTCGGA
TTAGGTGCTTCATTCCTCTTCCTTCTTCTCCCCAGTGTTAGCAAGAAGAAAGAAGAAAAC
GGAAATCAAGTTTCTGCTATTTCACAAGCCAAGAGTGTCTTTGTTTTAATGGGAACAAGA
AAAGTACGTCCTTTCTTACCTTTGATTTCTCTTGCTGGTGTTGTTGTAGCTTTTTACAGT
GGTTTCCTTTCTAAGCTCGTAAACAACTCTATTTAAGCTGATACCAACACTGATGATGGT
AAAGACGAAGTAAGCAAAAAACTTTCATTCGTTTTGATAGTTCTTGGTTGTAGTGAAGTT
ATTTCAGGTATTATTTCTGGTAAACTTGCTGATAAATTCAACATTTACAAAATCGCTATT
ATAGCTACAATTACTGTCTAGATTGCTCTTTTACTTTCTTTCTTAGGTCTTTACACTAAC
AGTTATTTGGTCTGTTTCTTTGTTGCTGCTTGCTGGGGTTTTAACGATTGCTTCTTACAA
AACGTTACATCTGTTATTTGTTCAAAAGATTATGAAGGATAACTCGAAATCTTCTAAATT
AATCGTTTCCTTTAAAGTATCACAGTAGCTATTGTTTAAATCATTAATGTCCTCTTGAAG
AACTCTCCTGATTATATTTTTGTTTTTATTATTTTTATCTTCTAGATGGTCACTAATTAC
TTCACAACTTATTTAGATAAGAAACCAGATATTAAATCTACTACCACACTTATAAAAGCT
AATTCAGATGAAGTTCATCATGATTTCGAATTAGAAAAATTAAAAAGCAAAAATTCAACT
GATAAAGCTATGCATTAAAATCTTGAAACATAAGGTGTTGCTGTTGCTTCAGCCAGCTGA


>TTHERM_00471390(protein)
MENTEKDLKIDSKAYLRGKLKVVVLSFTFMALFSTFNSAQNLVGSLYTSQGYDDLGLISL
FVVYIVFAFASFFANFFINKFSYKVIFFFSSLGYVAFAASGIWVCSCKNAIHEGACSKGV
IYFIVLASAALCGFSASTIWVAQGGYIDSISQDFPNKKGTLFGIFWAINQGSQIVGNLMG
MFILNYLDNLYYFLIMTFLGLGASFLFLLLPSVSKKKEENGNQVSAISQAKSVFVLMGTR
KVRPFLPLISLAGVVVAFYSGFLSKLVNNSIQADTNTDDGKDEVSKKLSFVLIVLGCSEV
ISGIISGKLADKFNIYKIAIIATITVQIALLLSFLGLYTNSYLVCFFVAACWGFNDCFLQ
NVTSVICSKDYEGQLEIFQINRFLQSITVAIVQIINVLLKNSPDYIFVFIIFIFQMVTNY
FTTYLDKKPDIKSTTTLIKANSDEVHHDFELEKLKSKNSTDKAMHQNLETQGVAVASAS


>TTHERM_00471390(gene)
ATGGAAAACACTGAAAAAGATCTAAAAATCGACTCAAAAGCCTACCTTAGAGGTAAACTG
AAAGTAGTTGTTTTATCATTTACTTTCATGGCTTTATTCTCCACTTTCAACTCTGCTTAG
AATCTTGTAGGAAGTCTTTACACCTCCTAAGGATATGATGACTTAGGTTTGATTTCTCTA
TTCGTTGTTTACATCGTATTTGCTTTCGCAAGTTTCTTTGCTAACTTCTTTATCAATAAA
TTCTCCTACAAGGTAATCTTCTTCTTCAGTAGTTTAGGTTACGTTGCTTTTGCAGCTTCT
GGTATTTGGGTTTGCTCATGTAAGAATGCCATACATGAAGGTGCATGCTCTAAGGGTGTA
ATTTACTTCATAGTCCTTGCCTCTGCAGCCCTTTGTGGTTTCAGTGCTTCTACAATTTGG
GTAGCATAAGGTGGCTATATTGATTCAATCAGTTAAGATTTCCCTAACAAAAAGGGTACT
CTTTTTGGTATTTTCTGGGCTATCAACTAAGGTAGTTAAATTGTTGGTAATTTGATGGGT
ATGTTCATTCTTAACTATCTTGATAATCTATATTATTTCTTGATTATGACATTCCTCGGA
TTAGGTGCTTCATTCCTCTTCCTTCTTCTCCCCAGTGTTAGCAAGAAGAAAGAAGAAAAC
GGAAATCAAGTTTCTGCTATTTCACAAGCCAAGAGTGTCTTTGTTTTAATGGGAACAAGA
AAAGTACGTCCTTTCTTACCTTTGATTTCTCTTGCTGGTGTTGTTGTAGCTTTTTACAGT
GGTTTCCTTTCTAAGCTCGTAAACAACTCTATTTAAGCTGATACCAACACTGATGATGGT
AAAGACGAAGTAAGCAAAAAACTTTCATTCGTTTTGATAGTTCTTGGTTGTAGTGAAGTT
ATTTCAGGTATTATTTCTGGTAAACTTGCTGATAAATTCAACATTTACAAAATCGCTATT
ATAGCTACAATTACTGTCTAGATTGCTCTTTTACTTTCTTTCTTAGGTCTTTACACTAAC
AGTTATTTGGTCTGTTTCTTTGTTGCTGCTTGCTGGGGTTTTAACGATTGCTTCTTACAA
AACGTTACATCTGTTATTTGTTCAAAAGATTATGAAGGATAACTCGAAATCTTCTAAATT
AATCGTTTCCTTTAAAGTATCACAGTAGCTATTGTTTAAATCATTAATGTCCTCTTGAAG
AACTCTCCTGATTATATTTTTGTTTTTATTATTTTTATCTTCTAGATGGTCACTAATTAC
TTCACAACTTATTTAGATAAGAAACCAGATATTAAATCTACTACCACACTTATAAAAGCT
AATTCAGATGAAGTTCATCATGATTTCGAATTAGAAAAATTAAAAAGCAAAAATTCAACT
GATAAAGCTATGCATTAAAATCTTGAAACATAAGGTGTTGCTGTTGCTTCAGCCAGCTGA