Identifiers and Description

Gene Model Identifier

TTHERM_01146030

Standard Name

CAT1 (CATalase 1 )

Aliases

PreTt30119 | 254.m00025 | CAT

Description

Catalase; peroxisomal enzyme involved in the metabolism of hydrogen peroxide; enzyme activity induced by linolenic acid

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_01146030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_164370
WormBaseWBGene000008319.997093137033517e-262locus:ctl-2 Peroxisomal cata
lase 1 status:Confirmed Un
iProt:Q27487 protein_id:CAA2
2451.1
Tetrahymena borealisEI9_17124.19.997093137033517e-262catalase (491 aa)
DictyBaseDDB_G02745959.997093137033517e-262catA on chromosome: 2 position
3823148 to 3824719
OxytrichaContig8519.0.g179.997093137033517e-262Catalase
SGDYDR256C4.999288603441066e-168CTA1 Catalase A, breaks down h
ydrogen peroxide in the peroxi
somal matrix formed by acyl-Co
A oxidase (Pox1p) during fatty
acid beta-oxidation

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:2880840: Gotoh K, Takei M, Watanabe T, Suga T (1986) Effects of unsaturated fatty acids on the peroxisomal enzyme activities of Tetrahymena pyriformis. Journal of biochemistry 100(4):903-9
  2. Ref:4387403: Müller M, Hogg JF, De Duve C (1968) Distribution of tricarboxylic acid cycle enzymes and glyoxylate cycle enzymes between mitochondria and peroxisomes in Tetrahymena pyriformis. The Journal of biological chemistry 243(20):5385-95

Sequences

>TTHERM_01146030(coding)
ATGACTGACACAAAGAATACATCAGTATTGACAACCTCTACTGGTTCTCCAGTTGATGAC
AACCAAAATTCCGTCACTGCAGGTGAATACGGTCCCGTCTTATTATAAGACTTCCATCTT
ATTGATAAGTTGGCTCACTTTGACAGAGAAAGAATCCCTGAAAGAGTCGTCCACGCCAAA
GGTGCTGGTGCTTGGGGTTACTTCGAAGTTACCCATGACGTTACCAAGTTCTGCAAGGCC
AAGGTCTTCGAAACTGTTGGTAAGAGAACTCCCGTCTTCACCAGATTCTCTACCGTTGGT
GGTGAAAAGGGTTCTGCTGATACTGAACGTGATCCTCGTGGTTTCGCAGTCAAGTTCTAC
ACTGAAGAAGGCAATTGGGATATGGTTGGTAACAACACTCCCGTCTTCTTCATTAGAGAC
CCCATCAAATTCCCTGACTTCATTCACACCCAAAAGAGAAACCCTCAAACCAACCTCAAG
TGCGCTAACATGTTCTGGGACTTCCTTTCCTAGGTTCCTGAATCTGCTCACTAGGTTACC
ATTTTGTTCTCTGACAGAGGTACTCCCGATGGTTACAGAAGAATGAACGGTTACTCTTCT
CACACCTTCAAGTGGGTTAATGAATAAGGTGAAGCCTTCTGGGTTAAGCTCCACTTCAAG
ACTGACTCTGGTATTAAGAACTTCACTGCTGCTGAAGCTGATGCCCTTAAGTCTACCAAC
CCTGACTACGCTACTGAAGACCTCTTCAAGCACATTGCTTAAGGTGGTAGCGCTTCTTGG
ACCTTAAACGTCTAAGTTATGCCCATTAACGATGGCTACAAGTACAGATGGAACATTTTC
GATGTTACCAAGGTCTGGCCCCATGGTGACTATCCTTTGATCCCTGTTGGTAAGCTCGTC
TTAAACAGAAATCCTGAAAACTACTTTGCTGAAACTGAATAATCTGCTTTCTCTCCTTCC
CACTTAGTCCCTGGTATGGAACCCTCTTTGGATAAGATGCTCTAAGGTCGTCTCTTCTCT
TATCCCGATACCCACAGACACAGACTCGGTGCTAACTACGATCAAATTCCCGTTAACTGC
CCCTACAGAGCCAGAGTATCCAACAACTAACGTGATGGTCCCATGTGCGTCAACGGTAAT
CAAGGATCTAGAGTCAACTACGAACCTACCACTTTCCACAACTACAAGGTTAGACCCGAA
ACCAAGCTCTCTACCCAAAGAGTCACTGGTTTAGTTGGTCGTTTCAAACCCGCTCACCCC
AACGATGACTTCTCTCAACCCGGTGCTTTGTTCCGTAAGGTCATGTCAGATAAGGATAAA
TCTAACACCGTAAGCAACATTGTTGGCCACATTAAGAATGCTAACAGAGATATCCAAGAA
AGATAAGTCAGAATCTTCTACAAGTGCGATGCTGAATACGGTTCAAAGATTGCTACCGCT
CTCGGCTTCCCTGCTAACAGATCTAACCTCTGA


>TTHERM_01146030(protein)
MTDTKNTSVLTTSTGSPVDDNQNSVTAGEYGPVLLQDFHLIDKLAHFDRERIPERVVHAK
GAGAWGYFEVTHDVTKFCKAKVFETVGKRTPVFTRFSTVGGEKGSADTERDPRGFAVKFY
TEEGNWDMVGNNTPVFFIRDPIKFPDFIHTQKRNPQTNLKCANMFWDFLSQVPESAHQVT
ILFSDRGTPDGYRRMNGYSSHTFKWVNEQGEAFWVKLHFKTDSGIKNFTAAEADALKSTN
PDYATEDLFKHIAQGGSASWTLNVQVMPINDGYKYRWNIFDVTKVWPHGDYPLIPVGKLV
LNRNPENYFAETEQSAFSPSHLVPGMEPSLDKMLQGRLFSYPDTHRHRLGANYDQIPVNC
PYRARVSNNQRDGPMCVNGNQGSRVNYEPTTFHNYKVRPETKLSTQRVTGLVGRFKPAHP
NDDFSQPGALFRKVMSDKDKSNTVSNIVGHIKNANRDIQERQVRIFYKCDAEYGSKIATA
LGFPANRSNL


>TTHERM_01146030(gene)
ATGACTGACACAAAGAATACATCAGTATTGACAACCTCTACTGGTTCTCCAGTTGATGAC
AACCAAAATTCCGTCACTGCAGGTGAATACGGTCCCGTCTTATTATAAGACTTCCATCTT
ATTGATAAGTTGGCTCACTTTGACAGAGAAAGAATCCCTGAAAGAGTCGTCCACGCCAAA
GGTGCTGGTGCTTGGGGTTACTTCGAAGTTACCCATGACGTTACCAAGTTCTGCAAGGCC
AAGGTCTTCGAAACTGTTGGTAAGAGAACTCCCGTCTTCACCAGATTCTCTACCGTTGGT
GGTGAAAAGGGTTCTGCTGATACTGAACGTGATCCTCGTGGTTTCGCAGTCAAGTTCTAC
ACTGAAGAAGGCAATTGGGATATGGTAAAAACGTTAATAATTAATTTATCAAAAAGAAAT
TTATTGAAGTGAGTTGATTGATACTTTGCTAACAAGCAATATGAATGATTGTTGACAAAC
AAATCTATTAAACCATAGCATAAGAATTATACAAAATACTTTAAGATAAAACAAATTGCA
TAGTTTATTTGATCCACTAAGGAGACAGTAATTTCATTCAAAGATTTAAAAATATGAATG
AATGTTTTATAGGAGATCTTTTAAAAATTTGAAATGAAAACAAAATGATTAATTGTTTTG
GATTATAATAAACTTTGAGCAAGACAATTTAAAGTAAAGTAGAGTCTATTCACTTCAATA
ACATCATTAAATAGTTAATATATATATCAAATAACTTACTAACTAACTACATTAAAATAA
ATAAAGGTTGGTAACAACACTCCCGTCTTCTTCATTAGAGACCCCATCAAATTCCCTGAC
TTCATTCACACCCAAAAGAGAAACCCTCAAACCAACCTCAAGTGCGCTAACATGTTCTGG
GACTTCCTTTCCTAGGTTCCTGAATCTGCTCACTAGGTAATGAATAAGACAATTGATTAA
TTTTGTTGTTTACTTTAATTTTCTTTTCTTCTTGTTAATGAGTTGATAGATATATGAAAT
AAACAAACAAACAAACTAAGAAATCAATAAAGAAATAAACAAACAAACAAACTAGTCTAT
TAAATGAATTAATTTAAAATAATGCAAATTTAATAATTAAATTAAAAGAAATGTAAAAGG
AACATTAGTTGAAACAATACAATTATTTGATGGAAATAAATATTGATAATATTATTAATT
TCTTCTTTTTTACATTTAGAAAAATTCTTATTTCGATTGAATCATTCCATAATTTAAAAA
ATTTTTAATTAAGTCCTTATTTTACGCAATTATCACACAGCCTGCTCATTTTATAAAATT
TAAATTTTCCTTCAAATTTAAGTTTGTTTCTTGAATTTTCTATCTAAGATATTGCTGTTA
CCATTTTTAAAAAAATATTAGAATACTCAGCATAAATTATTAAAGCTAAATAAAATAAAC
TAGAATTATACTCAAATAAGCTTATAATTAGATTTTAAATATGCAAAAATTGATTAATTA
CTTATTCGCATGTTTTATGAAAATAATATGAATGAATGATTCAACTGATTTTAAGTAGAA
ATAAATATTCCAACTTTATAAATTTAATTAAATTGTAAGAAAAGAATGTAAAACAATAAA
GAAGAATTGTCTATTTATTTAATATTTACTAATTCAATTTACACGCTCAAACTAAATTAA
AATTTTGAAATATTGCTTCTTTTATATTATTTATTTGCTTACTTAATATTTTAATTCTAA
TTAATAGGTTACCATTTTGTTCTCTGACAGAGGTACTCCCGATGGTTACAGAAGAATGAA
CGGTTACTCTTCTCACACCTTCAAGTGGGTTAATGAATAAGGTGAAGCCTTCTGGGTTAA
GCTCCACTTCAAGACTGACTCTGGTATTAAGAACTTCACTGCTGCTGAAGCTGATGCCCT
TAAGTCTACCAACCCTGACTACGCTACTGAAGACCTCTTCAAGCACATTGCTTAAGGTAA
ATAAAATAAAATGATTTAATTTAGTATATTCTAATCGTTAATATTAAACAAAATTAGGTG
GTAGCGCTTCTTGGACCTTAAACGTCTAAGTTATGCCCATTAACGATGGCTACAAGTACA
GATGGAACATTTTCGATGTTACCAAGGTCTGGCCCCATGGTGACTATCCTTTGATCCCTG
TTGGTAAGCTCGTCTTAAACAGAAATCCTGAAAACTACTTTGCTGAAACTGAATAATCTG
CTTTCTCTCCTTCCCACTTAGTCCCTGGTATGGAACCCTCTTTGGATAAGATGCTCTAAG
GTCGTCTCTTCTCTTATCCCGATACCCACAGACACAGACTCGGTGCTAACTACGATCAAA
TTCCCGTTAACTGCCCCTACAGAGCCAGAGTATCCAACAACTAACGTGATGGTCCCATGT
GCGTCAACGGTAATCAAGGATCTAGAGTCAACTACGAACCTACCACTTTCCACAACTACA
AGGTTAGACCCGAAACCAAGCTCTCTACCCAAAGAGTCACTGGTTTAGTTGGTAATTAAT
TATCATATTAAAAGTCTTAAAACAAGTACTTAATTTAATTTTTACAAATAAAAAAGGTCG
TTTCAAACCCGCTCACCCCAACGATGACTTCTCTCAACCCGGTGCTTTGTTCCGTAAGGT
CATGTCAGATAAGGATAAATCTAACACCGTAAGCAACATTGTTGGCCACATTAAGAATGC
TAACAGAGATATCCAAGAAAGATAAGTCAGAATCTTCTACAAGTGCGATGCTGAATACGG
TTCAAAGATTGCTACCGCTCTCGGCTTCCCTGCTAACAGATCTAACCTCTGA