Identifiers and Description

Gene Model Identifier

TTHERM_00410180

Standard Name

CAR1 (carboxypeptidase 1 )

Aliases

PreTt21535 | 44.m00202 | 3714.m00049

Description

Zinc carboxypeptidase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 79.3%

TetraMine Data

TTHERM_00410180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10314.19.997093137033517e-262hypothetical protein (945 aa)
Stentor CoeruleusSteCoe_178431.9287498479639178e-22
WormBaseWBGene000219840.00000000009998509410508463status:Confirmed UniProt:Q9T
ZC6 protein_id:CCD66460.1
SGDYHR132C0.000000019990673443141236ECM14 Putative metalloprotease
with similarity to the zinc c
arboxypeptidase family, requir
ed for normal cell wall assemb
ly

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00410180(coding)
ATGATTAAAATAAACAAATTTACAATAAGTTTAATAGTAATAACAACACTGTTTTTACAA
GTCTCTCAATGCTCAAAGATAAATTTTGATATCTACCATACTACCGATGAAATAAATCTA
CTACTTCAACAGCTAGATGGTAATTGTGAAGGCTATAGCTTAAATTTGGCTAATGATGAT
CCTGATATTTATGAAGTCACTTTAAGCTCACTAGAAAGCGATAAACCACTTAAAGCACTT
ATAATTTTTGGCGAGCATCCAAGAGAATTAATATCACCTGAAACTGGTTTAAATTTTCTT
AAATCTTTATGCGGATAAAGTTAATTTGGAGATTATGAACTAACACAAAAAATAAGGGAT
AACTATGATCTGAAGCTAATCATTAATTCAAATCCTAATTCTAGAAGATTAGTAGAAGAA
GGTGATTATTGCAAGCGTGAAAATCCAAATTTTGTAGATATTAATAGAAATTGGGGTAGT
CACTGGGAACATGTCTAAGATGAATAAAGGTAAGTTAATTCAGGCGAAGCTCCTTTTAGC
GAAATAGAAACTTAGGTTTTAAAAAAAATAGCCACTGATTTTTCACCTAATGTTTTCATT
TCAATTCACTCTGGTACTTTAGGTCTCTATACTCCTTATGCTTATACAAACTAAAGAGCT
GAAAGAAATGAAGAACATATGATCAATATTGTGAGTGATATATAAAAAAAATATTGCAAA
AATTGTAGTGTTGGAGCTGCTGGAAAAGAAGTAGGTTACCTTTGTCCTGGAACTTGTTTG
GACTATATTTATGAAACCCTTGAAGCTGATTATTCTTTTGCATTTGAAATTTATTCAAAC
GAAAATGAAATTCATTAAGCTCTTGAAGGTAGTAGCTTTTTACAAATGAGATCTAGAAAT
CAAAGACTTCGTCATACTTTTAGAAGAAGCGAATAATTCCGTCCATCATCGTGTTTCCTT
CAATCCAGTTCTGAATCAAGCAACGATACTGATTCCGATAGTTTATCAGATCTTTTTTCA
GATAGTTATTAACAGTGCTTCTTATTTTTTAATCCTGAATCTCATGATGATTATGATTTT
GTTATTGATAATTGGACAAAGGCTCTTTATGAGACTCTTAACCATGTTACTGATAACAAA
ACCTTATGA


>TTHERM_00410180(protein)
MIKINKFTISLIVITTLFLQVSQCSKINFDIYHTTDEINLLLQQLDGNCEGYSLNLANDD
PDIYEVTLSSLESDKPLKALIIFGEHPRELISPETGLNFLKSLCGQSQFGDYELTQKIRD
NYDLKLIINSNPNSRRLVEEGDYCKRENPNFVDINRNWGSHWEHVQDEQRQVNSGEAPFS
EIETQVLKKIATDFSPNVFISIHSGTLGLYTPYAYTNQRAERNEEHMINIVSDIQKKYCK
NCSVGAAGKEVGYLCPGTCLDYIYETLEADYSFAFEIYSNENEIHQALEGSSFLQMRSRN
QRLRHTFRRSEQFRPSSCFLQSSSESSNDTDSDSLSDLFSDSYQQCFLFFNPESHDDYDF
VIDNWTKALYETLNHVTDNKTL


>TTHERM_00410180(gene)
ATGATTAAAATAAACAAATTTACAATAAGTTTAATAGTAATAACAACACTGTTTTTACAA
GTCTCTCAATGCTCAAAGATAAATTTTGATATCTACCATACTACCGATGTAAAAAAATAG
AAATATTTCATTCTTTTACTGATTTTTATGTAGAGAATGAAGTATAATTTATCAATAACA
TACATACATAGATAAAGGATATTTACAATCATTTTTTATTTAAAATAAATTAGGAAATAA
ATCTACTACTTCAACAGCTAGATGGTAATTGTGAAGGCTATAGCTTAGTAATTTTTTTTG
ACTTCATATAATTGTTTATTTTATTTTACATTTAATTTAATAGAATTTGGCTAATGATGA
TCCTGATATTTATGAAGTCACTTTAAGCTCACTAGAAAGCGATAAACCACTTAAAGCACT
TATAATTTTTGGCGAGCATCCAAGAGAATTAATATCACCTGAAACTGGTTTAAATTTTCT
TAAATCTTTATGCGGATAAAGTTAATTTGGAGATTATGAACTAACACAAAAAATAAGGGA
TAACTATGATCTGAAGCTAATCATTAATTCAAATCCTAATTCTAGAAGATTAGTAGAAGA
AGGTGATTATTGCAAGCGTGAAAATCCAAATTTTGTAGATATTAATAGAAATTGGGGTAG
TCACTGGGAACATGTAAAATTTCTTAAAAATTGAATGTTTTAATATTTAATACATGAATA
TTATTTAGGTCTAAGATGAATAAAGGTAAGTTAATTCAGGCGAAGCTCCTTTTAGCGAAA
TAGAAACTTAGGTTTTAAAAAAAATAGCCACTGATTTTTCACCTAATGTTTTCATTTCAA
TTCACTCTGGTACTTTAGGTCTCTATACTCCTTATGCTTATACAAACTAAAGAGGTAAAT
AAATTAATTTTTATATCATTTGATTTTAATGTATTTATATTTTTTTAAATTTAAAATGTT
TTATTGAAATAACTATGTTTATTTAAAATTAAATAGCTGAAAGAAATGAAGAACATATGA
TCAATATTGTGAGTGATATATAAAAAAAATATTGCAAAAATTGTAGTGTTGGAGCTGCTG
GAAAAGAAGTAGGTTACCTTTGTCCTGGAACTTGTTTGGACTATATTTATGAAACCCTTG
AAGCTGATTATTCTTTTGCATTTGAAATTTATTCAAACGAAAATGAAATTCATTAAGCTC
TTGAAGGTAGTAGCTTTTTACAAATGAGATCTAGAAATCAAAGACTTCGTCATACTTTTA
GAAGAAGCGAATAATTCCGTCCATCATCGTGTTTCCTTCAATCCAGGTATTCTTTTTTTC
AAAAATATTTTGTTAAAATATTTTTTTAATAGTTCTGAATCAAGCAACGATACTGATTCC
GATAGTTTATCAGATCTTTTTTCAGATAGTTATTAACAGTGCTTCTTATTTTTTAATCCT
GAATCTCATGATGATTATGATTTTGTTATTGATAATTGGACAAAGGTAAATAAATATAAT
GAAAAACATATTTTAATTTATTTAAAAATATTAGGCTCTTTATGAGACTCTTAACCATGT
TACTGATAACAAAACCTTATGA