Identifiers and Description

Gene Model Identifier

TTHERM_00630500

Standard Name

CAM1 (CAlModulin)

Aliases

PreTt06563 | 89.m00157 | 3831.m01458

Description

Calmodulin (CaM); EF hand family; 1 of 3 proteins similar to mammalian CaM; uniquely activates ciliary membrane associated guanylate cyclase; regulates ciliary dynein ATPase and F-actin bundling activity of EF-1 alpha; regulates cytokinesis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00630500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04344.16.999576669079256e-104EF hand family protein (150 aa
)
OxytrichaContig4133.0.g469.99679536751975e-103EF hand
WormBaseWBGene000005529.99583921019208e-96locus:cmd-1 Calmodulin sta
tus:Confirmed UniProt:O16305
protein_id:CCD69969.1
DictyBaseDDB_G02794071.999022616705709e-90calA on chromosome: 3 position
2244074 to 2245039
SGDYBR109C1.9997677415930956e-65CMD1 Calmodulin; Ca++ binding
protein that regulates Ca++ in
dependent processes (mitosis,
bud growth, actin organization
, endocytosis, etc.) and Ca++
dependent processes (stress-ac
tivated pathways), targets inc
lude Nuf1p, Myo2p and calcineu
rin
Stentor CoeruleusSteCoe_95086.813556821545298e-46

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00630500(coding)
ATGGCTGATCAATTAACTGAAGAACAAATTGCTGAATTCAAGGAAGCTTTCTCCTTGTTC
GATAAGGATGGTGATGGTACCATTACCACCAAGGAATTGGGTACTGTCATGAGATCTTTG
GGTCAAAACCCCACTGAAGCTGAACTCTAAGATATGATTAACGAAGTCGATGCTGATGGT
AACGGTACTATCGATTTCCCTGAATTCTTAAGTTTGATGGCCAGAAAGATGAAAGATACT
GATACTGAAGAAGAACTTATTGAAGCCTTCAAGGTCTTCGATAGAGATGGTAATGGTCTC
ATTTCTGCCGCTGAATTAAGACACGTCATGACTAATCTCGGTGAAAAGCTTACTGACGAA
GAAGTCGATGAAATGATTAGAGAAGCTGATATTGATGGTGATGGTCACATTAACTACGAA
GAATTCGTTAGAATGATGATGGCTAAGTGA


>TTHERM_00630500(protein)
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLSLMARKMKDTDTEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGHINYEEFVRMMMAK


>TTHERM_00630500(gene)
ATGGCTGATCAATTAACTGAAGAACAAATTGCTGAATTCAAGGAAGCTTTCTCCTTGTTC
GATAAGGATGGTGATGGTACCATTACCACCAAGGAATTGGGTACTGTCATGAGATCTTTG
GGTAAGATTCTTTTCTTTTAAACTCTCCCCTTTCGAAGAAATAACTAATTTTCTTGATCT
TATTTTTTCTTCCTATTTTCTTTTTTTCTCTCCTTCAAACAAAAAATAGAACAGAGTTGT
TCCTTAAGCAAAGCATCATCTAGTGCTTAGCAAACTCAATACAAAATTCATTCAATGAAT
ATTGACTAGCAACTATTATTAAGATTTTTCGAAATAAATAGGCTTTCTTCTCCCTCCTCC
TTCTTGCTTATAAATAAAAATTTCACTTTCTTATAAGCTAATAAATAAATAAAAAAACAA
ATAGTTATATAATATCTTCAGTCAATAAAATTTCTATACGTTTTCAAGAATATATTATAC
AAGGCTATTCTATTTATTTTTCCAATTAGCAACCAATCGCATAGCAAATCTTTTAAGAAC
ATACATGAATTATACTAACATAAATAGCATTTAAGGATGCCTTCAAACATATATGCCATA
AAATGGCTACATTTTCATCAAAGTAAAAGATATTTCAGGAGCATTAAACGATCATCATTT
AAGAGTTGCTTATTTTTTCAATATTTTCAAACGAGTGAGGAAGAAAGCAAAAATATATTT
ATAAATAAATATTCATGCATGTTAAGGAGATCAGAAAAAATAATAGGAAGTTTAGAAAGA
TTGAAAGATATTCAACCAACTAACATGATAAATCTCATCAATCTTATAATTTTAAATAAA
TAGGTCAAAACCCCACTGAAGCTGAACTCTAAGATATGATTAACGAAGTCGATGCTGATG
GTAACGGTACTATCGATTTCCCTGAATTCTTAAGTTTGATGGCCAGAAAGATGAAAGATA
CTGATACTGAAGAAGAACTTATTGAAGCCTTCAAGGTCTTCGATAGAGATGGTAATGGTC
TCATTTCTGCCGCTGAATTAAGACACGTCATGACTAATCTCGGTGAAAAGCTTACTGACG
AAGAAGTCGATGAAATGATTAGAGAAGTAATTTATTATTTATTTATTAAATAATCTATAT
TATCTAGCTTCCATTTTTTAACTTCATTAAAATTAACTAATCAACCAACATTTTTTCAGA
GAACTTCAAAACTTTTAGTTAGTTAATAAGTTAGATTAGTTTTTCAAACAAATAAACATG
AAATAAATTAACATATCAGCCACTACATCGCAAGCAATTTGTTAAACGAACAAATAGCTG
CTCCATGGCAAAACAATAAATAAATAAATCAACACATAAAATGGAGTTTAAACAAACAAG
CTTTTTAATCAATCAATAAATCAACTAACCAACTAAACTAATTTCATGTATTTAATAAAT
AGGCTGATATTGATGGTGATGGTCACATTAACTACGAAGAATTCGTTAGAATGATGATGG
CTAAGTGA