Identifiers and Description

Gene Model Identifier

TTHERM_00529810

Standard Name

Brop-4 (Bromodomain containing protein 4)

Aliases

PreTt04650 | 67.m00165 | 3684.m00035

Description

Bromodomain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00529810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13669.17.996964956232603e-130bromodomain containing protein
(288 aa)
OxytrichaContig18584.0.g1087.003307964816097e-28Bromodomain
WormBaseWBGene000224734.997543945741262e-17locus:bet-1 status:Partially
_confirmed UniProt:Q95Y80
protein_id:CCD68309.1
SGDYDL070W9.997764199084386e-16BDF2 Protein involved in trans
cription initiation at TATA-co
ntaining promoters; associates
with the basal transcription
factor TFIID; contains two bro
modomains; corresponds to the
C-terminal region of mammalian
TAF1; redundant with Bdf1p
DictyBaseDDB_G02938000.000000000007996637300921877DDB_G0293800 on chromosome: 6
position 3334534 to 3337072
Stentor CoeruleusSteCoe_296930.000000000013887943864964021

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00529810(coding)
ATGGATAAATAAGTATAAAGTGAATGCAGTAAAGTTTTGAAATAGCTGCTTAAGTTACCA
GAATCATATCCTTTTAGAGAACCAGTCGATTATGAATAATTATAGTTATTTGATTACCCT
GATATTATAAAAAATCCTATGGATTTAGGCACGATAGAATAAAACTTAAAAGCAAAAAAA
TATAAATAGCCTAAAGACTTCTTTGATGACATATTTTTAGTGTGGAATAATTGTAAAATG
TACAATCAAGATGGATCTAACATTTATTAGTAAGCTTTAAATATGGAAAAAGCTACTAAT
GCTGCTAAATATGCTTTTGAATAGTCCTTAAAAAAGCTAAATTAAACCTAAGCACAAGCA
ACATAAAACCAATCTTCTTCAGCTGGCATAGCTGGTAAGTAAAAAAAGACAGAAAAATCA
GTTAGTTCATCTATAATTAAAAAGAAAATCCATAAAAACAAAGAAGGAAGCAGTAGCATT
ACAGTAAATACTAATACAAACGTGAATGTAGCATCAGGAAATAATAATAATGGAAATAAC
AATAATACTTAATATTAACAATAATAAAATGTCTAGAGTGTATAATATAGTAAAAAAGAA
AGGCAACCACCTGTCAATAAAAATGAATAATAGTAAGAAAAATATGCTAATTAGCAAGAA
AGAAAATATGCTCATATATCACTTAGATTAAATTTAGCTTTTAAATTAAAAAATGCTACA
GAAGATAAGTTAGTAAATTTATTTGCTATGCTTGCAGAAAAACACCCTGAAACACTTTCA
AATATAGAAAATAGAGAACAAAAGCTCTCTATGAATTTGACCTAGTTACCTGATCAAACT
ATTTAAAATATGATAGCAGCATTAGAATTCAAAGATTGA


>TTHERM_00529810(protein)
MDKQVQSECSKVLKQLLKLPESYPFREPVDYEQLQLFDYPDIIKNPMDLGTIEQNLKAKK
YKQPKDFFDDIFLVWNNCKMYNQDGSNIYQQALNMEKATNAAKYAFEQSLKKLNQTQAQA
TQNQSSSAGIAGKQKKTEKSVSSSIIKKKIHKNKEGSSSITVNTNTNVNVASGNNNNGNN
NNTQYQQQQNVQSVQYSKKERQPPVNKNEQQQEKYANQQERKYAHISLRLNLAFKLKNAT
EDKLVNLFAMLAEKHPETLSNIENREQKLSMNLTQLPDQTIQNMIAALEFKD


>TTHERM_00529810(gene)
ATGGATAAATAAGTATAAAGTGAATGCAGTAAAGTTTTGAAATAGCTGCTTAAGTTACCA
GAATCATATCCTTTTAGAGAACCAGTCGATTATGAATAATTATAGTTATTTGATTACCCT
GATATTATAAAAAATCCTATGGATTTAGGCACGATAGAATAAAACTTAAAAGCAAAAAAA
TATAAATAGCCTAAAGACTTCTTTGATGACATATTTTTAGTGTGGAATAATTGTAAAATG
TACAATCAAGATGGATCTAACATTTATTAGTAAGCTTTAAATATGGAAAAAGCTACTAAT
GCTGCTAAATATGCTTTTGAATAGTCCTTAAAAAAGCTAAATTAAACCTAAGCACAAGCA
ACATAAAACCAATCTTCTTCAGCTGGCATAGCTGGTAAGTAAAAAAAGACAGAAAAATCA
GTTAGTTCATCTATAATTAAAAAGAAAATCCATAAAAACAAAGAAGGAAGCAGTAGCATT
ACAGTAAATACTAATACAAACGTGAATGTAGCATCAGGAAATAATAATAATGGAAATAAC
AATAATACTTAATATTAACAATAATAAAATGTCTAGAGTGTATAATATAGTAAAAAAGAA
AGGCAACCACCTGTCAATAAAAATGAATAATAGTAAGAAAAATATGCTAATTAGCAAGAA
AGAAAATATGCTCATATATCACTTAGATTAAATTTAGCTTTTAAATTAAAAAATGCTACA
GAAGATAAGTTAGTAAATTTATTTGCTATGCTTGCAGAAAAACACCCTGAAACACTTTCA
AATATAGAAAATAGAGAACAAAAGCTCTCTATGAATTTGACCTAGTTACCTGATCAAACT
ATTTAAAATATGATAGCAGCATTAGAATTCAAAGATTGA