Identifiers and Description

Gene Model Identifier

TTHERM_00146040

Standard Name

Brop-3 (Bromodomain containing protein 3)

Aliases

PreTt26811 | 11.m00508 | 3702.m00230

Description

Bromodomain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.9%

TetraMine Data

TTHERM_00146040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04669.11.999807452113044e-171bromodomain containing protein
(310 aa)
OxytrichaContig18584.0.g1080.00000000000009996062864481225Bromodomain
SGDYGR252W0.000000000040005666873964816GCN5 Acetyltransferase, modifi
es N-terminal lysines on histo
nes H2B and H3; acetylates Rsc
4p, a subunit of the RSC chrom
atin-remodeling complex, alter
ing replication stress toleran
ce; catalytic subunit of the A
DA and SAGA histone acetyltran
sferase complexes; founding me
mber of the Gcn5p-related N-ac
etyltransferase superfamily; m
utant displays reduced transcr
iption elongation in the G-les
s-based run-on (GLRO) assay
WormBaseWBGene000072560.0000000000499999055251093locus:swsn-9 status:Confirme
d UniProt:Q17581 protein_i
d:CAA95779.1
DictyBaseDDB_G02745810.000000100009565553302DDB_G0274581 on chromosome: 2
position 3871056 to 3872872

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00146040(coding)
ATGAGCAAAGGCAAGAAAGATAAATTAGATTTAACAGTGGCATTAAATAATGTACTAAAC
GATATAATAGTTCAGGATCCTTAGCAAATATTTTATCTTCCTGTTGATACTAAGCTGTTT
TTTGATTATACAAAGAAAATAGCAAAGCCTATGGACTTATAAACCATGCAAAAAAAAATT
AAAAAGTATGTAGGCTATAAAGAATTTGAAAACGATCTTAATCTGATTTGGAGTAATTGT
AGAATCTACAATTAAGAAAATAGTGACATATATAAAGCATCTTTAAGATTGGAAAGATTA
TCAAAAAAGTCATTAAAGGAGCATCTTCTACCTTTTAAAGCTCATTATAGATTTGATGAG
AATGGAGTTCCAATTAAAAAAAGAAAATACAATCGTGTGAAGGATTCGTTAAACTCAAGT
TTGATTTAAACAAATGGAAATTAAAACTATTAATATGCATCATCTTATGGTATTCCTTCC
AGAAAAACATCCTTAAGTGTAGATAAAAAAGAAAAAAGAGGCTCTAAAGGAGTAGCAAAA
TTGGCAAAGGCTATAAAGAAAGGGAAAAAGCAAGATTTGTTAGGATTAAAAAAAGCTCAA
TAAATACCAGCTCTCCCTTAGAATTTAATATTTGACAAAAAAACTATAATTCACCCTCCT
AAATCTTCAAATTACAACTGTATTGTGATAGGATTGCAATAATAAATCTAATCTAAAGAA
AATCTTATTACTGAAGATGATAAGTAATTTTTGAAGTAGAAGGTTGTGAATTTTTCGTAA
GAAGAACTCTTTAAATGCATTAAAACAATATAAGAATATGAGCCTTAGCACATTTCCTAG
CAATCAAAAGAACACTATATTGTTAATTTTAATACACTCACTAAAATGGTTTTTAATAAA
ATAAAAGAATAATTTTCATTATGA


>TTHERM_00146040(protein)
MSKGKKDKLDLTVALNNVLNDIIVQDPQQIFYLPVDTKLFFDYTKKIAKPMDLQTMQKKI
KKYVGYKEFENDLNLIWSNCRIYNQENSDIYKASLRLERLSKKSLKEHLLPFKAHYRFDE
NGVPIKKRKYNRVKDSLNSSLIQTNGNQNYQYASSYGIPSRKTSLSVDKKEKRGSKGVAK
LAKAIKKGKKQDLLGLKKAQQIPALPQNLIFDKKTIIHPPKSSNYNCIVIGLQQQIQSKE
NLITEDDKQFLKQKVVNFSQEELFKCIKTIQEYEPQHISQQSKEHYIVNFNTLTKMVFNK
IKEQFSL


>TTHERM_00146040(gene)
ATGAGCAAAGGCAAGAAAGATAAATTAGATTTAACAGTGGCATTAAATAATGTACTAAAC
GATATAATAGTTCAGGATCCTTAGCAAATATTTTATCTTCCTGTTGATACTAAGCTGTTT
TTTGATTATACAAAGAAAATAGCAAAGCCTATGGACTTATAAACCATGCAAAAAAAAATT
AAAAAGGTAAAATTAGTACAAAAATTATATTTAAGTTAATTTTAGAATATATTTTTTGCA
AAATAACTATCGTTTCTATTTAATTCTGACAAAAATTATTTTATTTCATATTATATTTAG
ATAATATTTAATCTTTTCTAAACCTGTTTTAAAATCATTAATTCCCATTTTTTATCTTTA
AAGTATGTAGGCTATAAAGAATTTGAAAACGATCTTAATCTGATTTGGAGTAATTGTAGA
ATCTACAATTAAGAAAATAGTGACATATATAAAGCATCTTTAAGATTGGAAAGATTATCA
AAAAAGTCATTAAAGGAGCATCTTCTACCTTTTAAAGCTCATTATAGATTTGATGAGAAT
GGAGTTCCAATTAAAAAAAGAAAATACAATCGTGTGAAGGATTCGTTAAACTCAAGTTTG
ATTTAAACAAATGGAAATTAAAACTATTAATATGCATCATCTTATGGTATTCCTTCCAGA
AAAACATCCTTAAGTGTAGATAAAAAAGGTAAAAAGATAAAAAATTTACAAAAATAAATA
TGTTGATTATTTTTAATATCTAGAAAAAAGAGGCTCTAAAGGAGTAGCAAAATTGGCAAA
GGCTATAAAGAAAGGGAAAAAGCAAGATTTGTTAGGATTAAAAAAAGCTCAATAAATACC
AGCTCTCCCTTAGAATTTAATATTTGACAAAAAAACTATAATTCACCCTCCTAAATCTTC
AAATTACAACTGTATTGTGATAGGATTGCAATAATAAATCTAATCTAAAGAAAATCTTAT
TACTGAAGATGATAAGTAATTTTTGAAGTAGAAGGTTGTGAATTTTTCGTAAGAAGAACT
CTTTAAATGCATTAAAACAATATAAGAATATGAGCCTTAGCACATTTCCTAGCAATCAAA
AGAACACTATATTGTTAATTTTAATACACTCACTAAAATGGTTTTTAATAAAATAAAAGA
ATAATTTTCATTATGA