Identifiers and Description

Gene Model Identifier

TTHERM_00449140

Standard Name

Brop-2 (Bromodomain containing protein 2)

Aliases

PreTt15432 | 52.m00210 | 3811.m00967

Description

Bromodomain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 52.1%

TetraMine Data

TTHERM_00449140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14990.19.997093137033517e-262bromodomain containing protein
(364 aa)
OxytrichaContig18584.0.g1086.996829646809514e-23Bromodomain
WormBaseWBGene000174230.0000000000019997478866288316status:Confirmed UniProt:O76
561 protein_id:CCD69431.1
Stentor CoeruleusSteCoe_35450.000000000005109089028063325
SGDYIL126W0.00000000007999955850159168STH1 ATPase component of the R
SC chromatin remodeling comple
x; required for expression of
early meiotic genes; essential
helicase-related protein homo
logous to Snf2p
DictyBaseDDB_G02938000.00000000009998509410508463DDB_G0293800 on chromosome: 6
position 3334534 to 3337072

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00449140(coding)
ATGAATGCTGCAATGATCAATATAAAAAATATAATATTGTTTTTAATACTGAATAGCAAG
CAAGCAAACAAAAATAGTAAAGAAAATTAAGCAGAAACTAAGAAAGAAATTTAGTGTAAT
TAAAGCAAAAATAATTAATTAAATACAGATAATACTATGAAAAGCAATACTACCAAGGAA
AAGGCGCCAAAAACAGAAGCAACAAAAACTAAGTTAGACAGAGAACTAATTAAGAAGCTT
CATAAAATTTTAAATAACTTAATAAATGATCCCGAATCTGGCGAATTCAGGAAGCCTGTT
TACTATAAAGCTCTTGGATTAGAAGATTATAAAAAGATTATAAAGAAGCCAATGGATTTA
AATAGTGTTCGCAGAAATTTGAACAAAAATTCATATGAGTTTCTTGAAGAGGTTCTTGAT
GATATATAATTAGTTTGGAATAATTGCAAGTTATACAACGAGCAAGGATCATGGATTTAT
TTAACTGCAGTCAAGCTTGAAACGTTTTTCCATGACCAATGTTTAGAGTAATTCCCAAAC
ACACCTCTGCCTAGCAACAAAATACCCGATAGAGCCCTCCTATTATAGTAATATAACGAG
AAGAGCAATAAACAAAAGTAATCTCAGTCTAATAAAGATTAAACTAATGAAGAAGAATAA
AAAGGAGCTTCAAACACTTTGCCTCTACCAAAATTGGCAAATCAAAGTTCAAATACATCA
ACTTCTAATCCTTAAACTATTGCTCAGTCTTTGATTACAACATAATCTGAGTTTAACCAA
AATAAGCAATCTCAAAATGGAAATAATTCAGCTTAAGCATCTCTTACTGCAGCTAATCAA
TCAAAGACTACAAATATTGATCTGCCTTTTAAATTTACTAAAAAAGGTATAAAAAGAATA
TCATAAAAATAAGTTGTTCATATACCTTTTATGAAATTTGCTAATGATAAATAAAAATTT
GATTAGCTTATACAGACTACCAAAGCAGTCTCTAAGCTTTTAACAAACCAACAAAAGCAA
ATAATAGATATAATTCAAGAGTTTTAGCCTTCAATTATACAAACAGATGAAAATGAAGTT
AAAAATGTTGATTTTAATTAAGTGTCAGAGTATACCTATGAATTGATAACTTCCTATCTG
AATTTACTTAAAAATCAAGAATCAAGTGAATAAGTAATGGAAATAGAATCTGATGATGAA
AATAATATTGAGATACTAAATAACTAGCAATCAAACAATGTATCTTTAAACGTATGA


>TTHERM_00449140(protein)
MNAAMINIKNIILFLILNSKQANKNSKENQAETKKEIQCNQSKNNQLNTDNTMKSNTTKE
KAPKTEATKTKLDRELIKKLHKILNNLINDPESGEFRKPVYYKALGLEDYKKIIKKPMDL
NSVRRNLNKNSYEFLEEVLDDIQLVWNNCKLYNEQGSWIYLTAVKLETFFHDQCLEQFPN
TPLPSNKIPDRALLLQQYNEKSNKQKQSQSNKDQTNEEEQKGASNTLPLPKLANQSSNTS
TSNPQTIAQSLITTQSEFNQNKQSQNGNNSAQASLTAANQSKTTNIDLPFKFTKKGIKRI
SQKQVVHIPFMKFANDKQKFDQLIQTTKAVSKLLTNQQKQIIDIIQEFQPSIIQTDENEV
KNVDFNQVSEYTYELITSYLNLLKNQESSEQVMEIESDDENNIEILNNQQSNNVSLNV


>TTHERM_00449140(gene)
ATGAATGCTGCAATGATCAATATAAAAAATATAATATTGTTTTTAATACTGAATAGCAAG
CAAGCAAACAAAAATAGTAAAGAAAATTAAGCAGAAACTAAGAAAGAAATTTAGTGTAAT
TAAAGCAAAAATAATTAATTAAATACAGATAATACTATGAAAAGCAATACTACCAAGGAA
AAGGCGCCAAAAACAGAAGCAACAAAAACTAAGTTAGACAGAGAACTAATTAAGAAGCTT
CATAAAATTTTAAATAACTTAATAAATGATCCCGAATCTGGCGAATTCAGGAAGCCTGTT
TACTATAAAGCTCTTGGATTAGAAGATTATAAAAAGATTATAAAGAAGCCAATGGATTTA
AATAGTGTTCGCAGAAATTTGAACAAAAATTCATATGAGTTTCTTGAAGAGGTTCTTGAT
GATATATAATTAGTTTGGAATAATTGCAAGTTATACAACGAGCAAGGATCAGTAAATGAT
AAATTAATTTTAACTGGATTCGTTATTTTAAAAATAATTTTTTTCTATGCATTTGTTAAA
AGTGTTGAAAATGCATTCGTGATCAGCTATAAACTTCAAATAAACTTAATTTTTTTGCTT
TAAGTATTATTTTTTAAATAAAAAAGTGGATTTATTTAACTGCAGTCAAGCTTGAAACGT
TTTTCCATGACCAATGTTTAGAGTAATTCCCAAACACACCTCTGCCTAGCAACAAAATAC
GTATAAAATTGAATTTATCAGTCTTTTAATTATTTATTTAGAAGCTAACTTTAAATTAAT
TGCTAAATTATAAATCTACAAAGAATAAATGAAGAGAATATCTTTTTTGTAATTCTAACA
TTAATGATAATTCTAATTTATATTTGTTGAAAAACGAATGAAAATTTTATTTAAATTTAT
TATAGCCGATAGAGCCCTCCTATTATAGTAATATAACGAGAAGAGCAATAAACAAAAGTA
ATCTCAGTCTAATAAAGATTAAACTAATGAAGAAGAATAAAAAGGAGCTTCAAACACTTT
GCCTCTACCAAAATTGGCAAATCAAAGTTCAAATACATCAACTTCTAATCCTTAAACTAT
TGCTCAGTCTTTGATTACAACATAATCTGAGTTTAACCAAAATAAGCAATCTCAAAATGG
AAATAATTCAGCTTAAGCATCTCTTACTGCAGCTAATCAATCAAAGACTACAAATATTGA
TCTGCCTTTTAAATTTACTAAAAAAGGTATAAAAAGAATATCATAAAAATAAGTTGTTCA
TATACCTTTTATGAAATTTGCTAATGATAAATAAAAATTTGATTAGCTTATACAGACTAC
CAAAGCAGTCTCTAAGCTTTTAACAAACCAACAAAAGCAAGTAAATAAATAAATAAAATT
AAAAAATTGGATTATAAATCATTTTTAATAAACAGATAATAGATATAATTCAAGAGTTTT
AGCCTTCAATTATACAAACAGTAAAATTTTTGAAAGTAATTTAACTCTTATATAGATCAT
TTTTTTAAAAATAAAAGGATGAAAATGAAGTTAAAAATGTTGATTTTAATTAAGTGTCAG
AGTATACCTATGAATTGATAACTTCCTATCTGAATTTACTTAAAAATCAAGAATCAAGTG
AATAAGTAATGGAAATAGAATCTGATGATGAAAATAATATTGAGATACTAAATAACTAGC
AATCAAACAATGTATCTTTAAACGTATGA