Identifiers and Description

Gene Model Identifier

TTHERM_00715810

Standard Name

Brop-1 (Bromodomain containing protein 1)

Aliases

PreTt19055 | 113.m00094 | 3673.m00018

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.7%

TetraMine Data

TTHERM_00715810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16850.19.997093137033517e-262hypothetical protein (1370 aa)
OxytrichaContig18584.0.g1081.999598840915195e-17Bromodomain
DictyBaseDDB_G02701700.0000000000000700196834671948DDB_G0270170 on chromosome: 1
position 4360881 to 4366105
WormBaseWBGene000224730.000000000003001226732525078locus:bet-1 status:Partially
_confirmed UniProt:Q95Y80
protein_id:CCD68309.1
SGDYDL070W0.00000000030007160092483236BDF2 Protein involved in trans
cription initiation at TATA-co
ntaining promoters; associates
with the basal transcription
factor TFIID; contains two bro
modomains; corresponds to the
C-terminal region of mammalian
TAF1; redundant with Bdf1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00715810(coding)
ATGTCAAAGAAAATAGTGAAAGGAGGAGGTAGTAACACAGCAATTAAGAATACATCAAAA
CCTCTGGAAGAGAGTATTTTAGATATTATAAATGACATTAGCAAGCGTTAGTATTCGTTA
GATTTTAGAGAACCTGTCGATGTAAAAGCATTAGGATTGAGCGATTATTATGACATTGTT
AAAAAGCCAATGGACATATCCACTCTCAAAAATAATTTTTTGGAGGGTGTTTATAAGACA
ATAAAAGAAGTATGGGAAGATTTTGATTTAATCGTGAATAACTGCAAGGCTTATAATAGA
ATTCCAGACCACCCAATAAACCAAAAAGCTGATCAAATGAAAAGCCGTGTAGATAAAAAT
TTTTAAAAGTTATTAGAAGATTATAAGGCTCTAGGAGTTGATACAGATGGATACTAAATA
CAAATAGATTTAGATGATCTAAAGGCAAAAGAAGAAAAAAAAAGGAAGATTAAGTTAGAT
GGACTGGATGAAAAAAATATACTAATTGGCGGTGACAAAAGACTAAATCTTATCCCTGGT
TCATTAAATGAAAGAAAATTTTTCGAACTCTCAAATTAAGAATTATAGATGATGTAGGCA
GGAAAAAATATACAAATGTTGCCTCTCAACTAACCTTTGTAACAAGAGGATCCTGTGTTC
TAGCCAACGTCTTTGAAAATATCCTTAAACGCACCAAACTTAAGTTTGAATTTGAGTAAT
TCCACAATAACTGGCGAATAACCTACTCCAACTAATAATTAAGTTGGGATGAAATAACCT
AGAATAACTGGAGACAATACTTAAAAAGTAAAGAAATAAAAAGACTATTCAGCCAAAATA
TAAGAACTGCAAACTCTGCTTGCCTAACTCAAGCTTGAGCTTGAAGTTTAAACAAAAAAA
AAGTCTGATGTAGAAAAATAAAGAATCCTATGTAAAAATGTATACATTCTTTCAAAAAAA
TAAAGAAGAGGAGTCCATCAACTTGTTTAACAATTTGAAACAGAAGAAAATACCTTAATT
AATCCTGAAGGCACATTGAATAATTTTTCAACTCAAAGTAATCTAAATGGGAGTGAACAT
ATAAATGCTTAAGACATAAATGATGCAGCTACAAGTGGTACGTCCTTAAAAACCCCTTAA
AAAAGAGAAGATAATGGAAATCTTGATGATTAAACAGCTAAAAAAATGGAAATAGAAAAT
AAAGAAATATAGAAAAGTTAGGATCAAGAAGGTCGCTATAATGATGATGACGATGATGAT
AATGATATTATCATTAAAAAGAAAAGTAACTTTATTGACGATCTATCTCTAAAGTAAAAT
GAATCTACTTCTTAGATAGGATCTAATAAGATAAAAATTCCTACTTCTTAAACACTCAAC
AAGGAGGCCAACTCATCAACACAACTAAACGATTCGAAGATATCATTGAAATAGTCTCAA
ATAGGCCAAAAATCAAATAATGATTCATTCTCAACTCCAACAAAATAATAACTATTAAAC
AGCTCCAATTTATCATCTGAAAAAATTAAATAGAGTAGCAAAACTAACAATTTAAATGCT
TCAGAATCTAAATTTTAAAGTAATACAAATGACGGTGAAGAGAGTGAAGAAGAATTTGTA
CCTTAATCGCTAAATACTTCTAAATAGACTCCATCTGATTCTTTGGCTACACCATAATAA
ACTAATTCTATTAAACTACATGGACTCAAACCTACTAGCAGCACTGCTAATTCTGCCCAT
TTAAAGCATAAATTGCATGCTTCTGCTAGTGGAGATAAAATTTAAATTAAAAAGCCTACA
GATCTTAATAGTTCTCTACGAAAGGAAGGAGTCACACCAGAAAAAATTTTAAGCTAAGCA
AAAAAAGATTTCACTCCTGAAAAAAGTGGAAGCTCTGGTAAGCAACTTGCTAATTAATAG
GCAAAATAATTAGGCAATGGAAATAATCCTTAAAAAGTAAGACCAAACGGTCATTTAAAT
GGTTAAACAAATAGCTAAAGCAATTTATCTCCTTAGTCCTAGGAGCTTAAAAAAAAATTA
AATGCCAACACTCCAACTAAATCAGCTCTTTCTTAAGGAAAATCTACAATGAGTGGCAAT
GTCTTGCAAAAAAAGAATCCTTCCTCCGATAGTATTATAAAAGTGAAGATAGGAGGAGAA
TCTATATAAAAAAGTGTGTAAGATCTAAATGCAAATAAAATTAAAAGGCCAGAAGACGAA
ATAAAAATAAAGCTAAAAGATTCAACATTCAAAACTGCAGAAAAAGATGGGGAAGAAAGA
AAAGTAAACAAAATAACTATCCCAAATCCACAAGCAGCAGGTGGAAACTTTTTACCTACA
CCTGAATTGAAGCAGTCATAGAGTCTTAAGGCTGCATAAATTATTTAAATGGGTTAAGAG
AAAAAAAACAGAGAAATGGAAGAAAAGCAAAAAACTGAAGAGTAAAAGAGATTGGAAGAG
TTAAAAAAGAGATAAAATCGTCTTAAAAAGAAAGAATAAATGCTGCTATAAGCTCATTAA
TAAAAATAAGCTGAAGCTGCTGCTGCAGCAGCTGCAGCCGCTCTTGCTAATAATGAAGTT
TCTGATAAGCCAGTGAATACCAGCGAACCTCCAAAAATTATTCTTATGAAGAGTTAGAGT
TTAAAACCTGAAGAAGGTGCCTCCACAGGATCAAATTTAATAAAAATTCCTTTTGATGCC
TCATTAGCAAAAATGAGCTCAACTCAATCTTAACCAAATAGCCAACTTGACATTGGCTAC
AACTCAAGATAAATTTATGATAAAATTATCCCTTCAAAACCTAAGAAAACATAAAGCATA
TAGTAAGAGTAGAATGCAAATACATCAAATAGTCAAAATTTGAATTTCAATAAAATAAAG
ATTAATGTTGGAGGATCTCCAGTAATGCCACCTGCTAATAACCCATCTATTTAAAATTTT
CCTATTCCTTAAATTTCAGTTGGAGGTGAGCGTGTAGATTTTAAATTTGTTTTAGATAGA
AAGGCTCTTAAAAAAGAGTATGAGAACATGATAAAAAGAAAACAGTTAAAGTATAAAAAA
CTGCTGGAACTTAATCTAACAAAAATGTAGAAAGTAACTAATTGGATGATAAGAGAGTGG
GCAAAGTAGAAAAAAGATGTTCGTTCTGAAACTTTAGATTATTTTAGAGATATCTTAAAT
GAAAGATAGAAAATTAAAGATAATCTCGATATTCGTAAAATTCAGCTGTTCTTAAAAATG
TTTTTATACAGGCTCAGAGATTTCTACAAAGATCTCAAGCCTGATTATATTGACAAGCTG
AAAAATATTAGTGAAAAGCTATACAGAATTGGTTCTAGAGCTATTGTATACAAAACTCCA
CTCTCTATCAGAGATAACCCTAAAAACGCTTCATTAGATACTTAAGTCAGTAACAACTAG
ATCTTAGATGAATCTCATCCTTTGAAAAAATTGCAAGAGGAAATACTTGAAATAGAAAGA
GAAATGAAGCTGTTCCGTCGTATGCTTAGCAGAGATATCTAGAAATACTAAGAACCAGAT
GCGACAACTCAAAAGTCTAAAAAATCAAAAAACAAAGATGACGGAAGCTAATATAACGGA
GGTAATGATAACGATTAGTAAGGAGGATATATGAATGGTGGTTAAGGTTATGACGATTCA
AAAGATGCAATTTATGGAATGGGAGATAAAGATTAGTAATAAAAGTAAAGTGAAATACTG
TCATTCTTCTTGGAGTATAACAAAAGCTTTGAAAAGCACTCCTCTAATTTGCAAAAAATC
CAACACTTTTTGGCATATTAAAATTATAGCAATATTCTAAATTAATTATAGAGCAAGAAT
CCAATAAAGAGCGACTAACTATTTGATATATGCGAGACTTTTGTTGAAGATGAAAATAAT
AATTAAGTAGAAATTCTTTAATACTTCAAAAAAAAGAGAAAAATTTCTGAACATACATCT
TCAGAAAGTATGACAAATAACAATAATGATACAAAGATTGAAGAAGAAGGTAAATAAAAA
TAGAATGATTAAGAAATCGATGAATTAAATTCTAATATATTTGACAATGTTACTTTATCT
TTTAACTTCAATCTTGACTCTAAGAAAGAAGATGAAGAAGGAAAAGAAAACACTTTCATA
AGTAAAAGTCAAGACAATTCATTTAATAATCCAAAATAAGCAATAAATGTATTCAGTTAG
TTTGATGATGATGAAGATGATTCTACTGAAGCAATAATGGAAGAGAGAAAATATTAAGAG
TTTAAATCTAAAATAAACTAAAAAAATCTCAAAGAATGCAATAGTGGAAGTGATATTTTG
GGAAAAAATATAAGTGATATAAATATTTCCAACGTAATCAACCCAGAGTTTGACTATTTC
GGAGTGAAAAAACTCAATTAAATGATTAATAACAAAGTTATAAACAAAAAATTCTGCCAA
AATATAAACTCATTTATAAAATAGAAATTTTAAATTGTTGAAATCAACAAAATAAAATGC
AAAAATGCTATTATTTACTAAAAAATGAAAACAAATGATGATCTAGTTAAAAATTTATAT
TAAAAATAGTAATTATTAGAGCCAAAGATAAATATTAAAATAGCTCCTCCGTTTTTGGAT
GATCTCAATATTAATTGTTTGCAAACACTAATAAATTTATAAATTTAGGTTGAATTGAGA
CTTGAGAATGAATAAAATCCTAAAAGCTAAATGGATATAGAAAATAGCCAAAACAACTAA
GCTGAAAAATCTTTAGAATTTCATATTTAAAATAATGTTAACTATGCTTGTTGTGCATAC
TTTACAGAGTTACCCAATATAAAGGATGAAATATAGCTAAATTGTAAAGAAAATGCTGAC
TTCTATTCGATTCTATGCTAAGAAGATGTAGAGCAAGTTGTTTAATCATTTAAAATATAG
AAACAATTATATAGATTGTTATCGTAAGATAGCTTCTTAACTTAAGAAGTAATAAATAGT
GAGGCAGTTTGTATAACAAAATAAAGATTAAGATAAATTGATCCTTAAAACAACAAATTT
TTGTTAGAAATTTCTCTCTGGACTCCTACTGATAATCTAGGTTATTTATCAATAAAACTA
AACAATGAAGAAATATTTTCACCACTCAATTTTATTTAAAAAATAAAAAAGTTTTAACAA
TATCAGATTTAACAAAAGCAAATTTAACAACAACAACAACAACAATTGTAATAACAACAA
AAAAAATATATCTAAAATCAATCACAATGA


>TTHERM_00715810(protein)
MSKKIVKGGGSNTAIKNTSKPLEESILDIINDISKRQYSLDFREPVDVKALGLSDYYDIV
KKPMDISTLKNNFLEGVYKTIKEVWEDFDLIVNNCKAYNRIPDHPINQKADQMKSRVDKN
FQKLLEDYKALGVDTDGYQIQIDLDDLKAKEEKKRKIKLDGLDEKNILIGGDKRLNLIPG
SLNERKFFELSNQELQMMQAGKNIQMLPLNQPLQQEDPVFQPTSLKISLNAPNLSLNLSN
STITGEQPTPTNNQVGMKQPRITGDNTQKVKKQKDYSAKIQELQTLLAQLKLELEVQTKK
KSDVEKQRILCKNVYILSKKQRRGVHQLVQQFETEENTLINPEGTLNNFSTQSNLNGSEH
INAQDINDAATSGTSLKTPQKREDNGNLDDQTAKKMEIENKEIQKSQDQEGRYNDDDDDD
NDIIIKKKSNFIDDLSLKQNESTSQIGSNKIKIPTSQTLNKEANSSTQLNDSKISLKQSQ
IGQKSNNDSFSTPTKQQLLNSSNLSSEKIKQSSKTNNLNASESKFQSNTNDGEESEEEFV
PQSLNTSKQTPSDSLATPQQTNSIKLHGLKPTSSTANSAHLKHKLHASASGDKIQIKKPT
DLNSSLRKEGVTPEKILSQAKKDFTPEKSGSSGKQLANQQAKQLGNGNNPQKVRPNGHLN
GQTNSQSNLSPQSQELKKKLNANTPTKSALSQGKSTMSGNVLQKKNPSSDSIIKVKIGGE
SIQKSVQDLNANKIKRPEDEIKIKLKDSTFKTAEKDGEERKVNKITIPNPQAAGGNFLPT
PELKQSQSLKAAQIIQMGQEKKNREMEEKQKTEEQKRLEELKKRQNRLKKKEQMLLQAHQ
QKQAEAAAAAAAAALANNEVSDKPVNTSEPPKIILMKSQSLKPEEGASTGSNLIKIPFDA
SLAKMSSTQSQPNSQLDIGYNSRQIYDKIIPSKPKKTQSIQQEQNANTSNSQNLNFNKIK
INVGGSPVMPPANNPSIQNFPIPQISVGGERVDFKFVLDRKALKKEYENMIKRKQLKYKK
LLELNLTKMQKVTNWMIREWAKQKKDVRSETLDYFRDILNERQKIKDNLDIRKIQLFLKM
FLYRLRDFYKDLKPDYIDKLKNISEKLYRIGSRAIVYKTPLSIRDNPKNASLDTQVSNNQ
ILDESHPLKKLQEEILEIEREMKLFRRMLSRDIQKYQEPDATTQKSKKSKNKDDGSQYNG
GNDNDQQGGYMNGGQGYDDSKDAIYGMGDKDQQQKQSEILSFFLEYNKSFEKHSSNLQKI
QHFLAYQNYSNILNQLQSKNPIKSDQLFDICETFVEDENNNQVEILQYFKKKRKISEHTS
SESMTNNNNDTKIEEEGKQKQNDQEIDELNSNIFDNVTLSFNFNLDSKKEDEEGKENTFI
SKSQDNSFNNPKQAINVFSQFDDDEDDSTEAIMEERKYQEFKSKINQKNLKECNSGSDIL
GKNISDINISNVINPEFDYFGVKKLNQMINNKVINKKFCQNINSFIKQKFQIVEINKIKC
KNAIIYQKMKTNDDLVKNLYQKQQLLEPKINIKIAPPFLDDLNINCLQTLINLQIQVELR
LENEQNPKSQMDIENSQNNQAEKSLEFHIQNNVNYACCAYFTELPNIKDEIQLNCKENAD
FYSILCQEDVEQVVQSFKIQKQLYRLLSQDSFLTQEVINSEAVCITKQRLRQIDPQNNKF
LLEISLWTPTDNLGYLSIKLNNEEIFSPLNFIQKIKKFQQYQIQQKQIQQQQQQQLQQQQ
KKYIQNQSQ


>TTHERM_00715810(gene)
ATGTCAAAGAAAATAGTGAAAGGAGGAGGTAGTAACACAGCAATTAAGAATACATCAAAA
CCTCTGGAAGAGAGTATTTTAGATATTATAAATGACATTAGCAAGCGTTAGTATTCGTTA
GATTTTAGAGAACCTGTCGATGTAAAAGCATTAGGATTGAGCGATTATTATGACATTGTT
AAAAAGCCAATGGACATATCCACTCTCAAAGTCGGTGCTTTTTTTATCCTCCTTATATAT
TCATAAAAATTATTTAAACCCATTATTGAGCAAATATATTTTTTAGTAGACTAACCATCA
CTAGATTGATACAAAAAGAGTAATTATGAAAAGCAGTTCATATTGTATTTCATTTTAAAT
TTTTGATTATTGCAGCCAACCCCATTTCGCTTACTTAGTAAGGAGATCGATCGATCAATC
AAAATAAACAAACAATGTGAATATTTTCAAAATATTTCTGATAAAATAAAAACATGATAC
GATTGATAGTTGATGGTTAGTTGCTCTTTAGACAGCTAGATTGCAAACTAGCTTTCGCAT
GAATTAGTTTGAAAAAATCTTAAAACAATATATTTATTTATATTTTTATTTGTAAAAATT
TCTACATTAGAATAATTTTTTGGAGGGTGTTTATAAGACAATAAAAGAAGTATGGGAAGA
TTTTGATTTAATCGTGAATAACTGCAAGGCTTATAATAGAATTCCAGACCACCCAATAAA
CCAAAAAGCTGATCAAATGAAAAGCCGTGTAGATAAAAATTTTTAAAAGTTATTAGAAGA
TTATAAGGCTCTAGGTATTTAAGAAAGAATATTATTTTTTTTTTCATTTTATGCAATGAT
TTATTCAGTTTAGGAAGTAAGTGCACAAAGAAATTTTTGATTTGAAATTTAGACAAAAGA
CATCAAATAAGTTAGTTAGTTAGACATAATCAAATAAAACAAAACTTTTCAATATACTTT
TTAATTATTATTGTTTTACTGCTTTTTTGTCAGAAGTTTGTCATTTAAAGAAAGAAAAAA
TTGATGTAAATTGGAAACAAAATATTAAACTAATTTAAAATTTTACACAAATTATCATCC
AACCTCCCACCCACCCACCGAATAAAATAAAACTCAATAAGCTAATTCTTTTTTAGCACA
AACAAATAAAAAATTATGATTATATTCTCATTTAATCCATCTTTCTAATTTTCTATTTTA
ATTCCCACTTATTCTTGCATATTATTTATGGATTTTTTTAACTTTTTCAATATAGCAAAT
AATTGCATCAATTACTCTCCATGCAATAAAGCTTTGGCTAAAAATATATTCTTTTTTGAC
ATGTGTTTTTAGCGAAGCCTATGCAAAATTTTTATCTAAAATGATTAGAATTGTATGCTC
AACTCTCTGTCTCTATCAGCATCTTAATTTAGATATGCACGAGGAGAGTTTGTTTCTCTT
TTACAGATTTCCTCTTTTTTTTTTATTTTTAGAGATTTTGACAAAATTCATTTTTTAACA
AATTTAATTAATTATAAGAATTTCTAACTCCCCCTCTTAATTTGAATTAAGGATTTTAAT
TTCAAAGGATGATTACTTACTGAGTTTTCATAATATTAATTAAATTAATTGCAAAAATAG
ATCTTCTTCATTCAATATTCTCCCCACCCAATCTCTATCTTTTTTTAATTCACCAAAATC
TAAATTATTCTTATTACTATAAACAGAATCAGGTTTGATTGATTGCTTTCTAAATAAATT
GATTATTATTAATTTCTTTTGCTTTACATCTAATTTTCTTTCTTTAATTATTTTGTGCCT
CTAAAAGAATAAATACATACATACATTCATCTACCATTTTTGATATTAAAAAATTAATGT
GAACAATCTTACTAGCATGTTTTCTAATATAAAAATTTAATATTAGGAGTTGATACAGAT
GGATACTAAATACAAATAGATTTAGATGATCTAAAGGCAAAAGAAGAAAAAAAAAGGAAG
ATTAAGTTAGATGGACTGGATGAAAAAAATATACTAATTGGCGGTGACAAAAGACTAAAT
CTTATCCCTGGTTCATTAAATGAAAGAAAATTTTTCGAACTCTCAAATTAAGAATTATAG
ATGATGTAGGCAGGAAAAAATATACAAATGTTGCCTCTCAACTAACCTTTGTAACAAGAG
GATCCTGTGTTCTAGCCAACGTCTTTGAAAATATCCTTAAACGCACCAAACTTAAGTTTG
AATTTGAGTAATTCCACAATAACTGGCGAATAACCTACTCCAACTAATAATTAAGTTGGG
ATGAAATAACCTAGAATAACTGGAGACAATACTTAAAAAGTAAAGAAATAAAAAGACTAT
TCAGCCAAAATATAAGAACTGCAAACTCTGCTTGCCTAACTCAAGCTTGAGCTTGAAGTT
TAAACAAAAAAAAAGTCTGATGTAGAAAAATAAAGAATCCTATGTAAAAATGTATACATT
CTTTCAAAAAAATAAAGAAGAGGAGTCCATCAACTTGTTTAACAATTTGAAACAGAAGAA
AATACCTTAATTAATCCTGAAGGCACATTGTAAAAAAAATACATTTATGATAAAAAAATA
CCACCACACACTTTAATTTCATTTTAAGCTTCTTTTAAAAAAGTGGCTTTCAATAATGAT
TTATTAATTATAATTTGTTTATTCAAAAGGAATAATTTTTCAACTCAAAGTAATCTAAAT
GGGAGTGAACATATAAATGCTTAAGACATAAATGATGCAGCTACAAGTGGTACGTCCTTA
AAAACCCCTTAAAAAAGAGAAGATAATGGAAATCTTGATGATTAAACAGCTAAAAAAATG
GAAATAGAAAATAAAGAAATATAGAAAAGTTAGGATCAAGAAGGTCGCTATAATGATGAT
GACGATGATGATAATGATATTATCATTAAAAAGAAAAGTAACTTTATTGACGATCTATCT
CTAAAGTAAAATGAATCTACTTCTTAGATAGGATCTAATAAGATAAAAATTCCTACTTCT
TAAACACTCAACAAGGAGGCCAACTCATCAACAGTAAAAATAAATAATCAACATAATACT
ATAATACTTTTTGTTTGATTCATTCAAATAACAAATATCTTAAAAATTAGCAACTAAACG
ATTCGAAGATATCATTGAAATAGTCTCAAATAGGCCAAAAATCAAATAATGATTCATTCT
CAACTCCAACAAAATAATAACTATTAAACAGCTCCAATTTATCATCTGAAAAAATTAAAT
AGAGTAGCAAAACTAACAATTTAAATGCTTCAGAATCTAAATTTTAAAGTAATACAAATG
ACGGTGAAGAGAGTGAAGAAGAATTTGTACCTTAATCGCTAAATACTTCTAAATAGACTC
CATCTGATTCTTTGGCTACACCATAATAAACTAATTCTATTAAACTACATGGACTCAAAC
CTACTAGCAGCACTGCTAATTCTGCCCATTTAAAGCATAAATTGCATGCTTCTGCTAGTG
GAGATAAAATTTAAATTAAAAAGCCTACAGATCTTAATAGTTCTCTACGAAAGGAAGGAG
TCACACCAGAAAAAATTTTAAGCTAAGCAAAAAAAGATTTCACTCCTGAAAAAAGTGGAA
GCTCTGGTAAGCAACTTGCTAATTAATAGGCAAAATAATTAGGCAATGGAAATAATCCTT
AAAAAGTAAGACCAAACGGTCATTTAAATGGTTAAACAAATAGCTAAAGCAATTTATCTC
CTTAGTCCTAGGAGCTTAAAAAAAAATTAAATGCCAACACTCCAACTAAATCAGCTCTTT
CTTAAGGAAAATCTACAATGAGTGGCAATGTCTTGCAAAAAAAGAATCCTTCCTCCGATA
GTATTATAAAAGTGAAGATAGGAGGAGAATCTATATAAAAAAGTGTGTAAGATCTAAATG
CAAATAAAATTAAAAGGCCAGAAGACGAAATAAAAATAAAGCTAAAAGATTCAACATTCA
AAACTGCAGAAAAAGATGGGGAAGAAAGAAAAGTAAACAAAATAACTATCCCAAATCCAC
AAGCAGCAGGTGGAAACTTTTTACCTACACCTGAATTGAAGCAGTCATAGAGTCTTAAGG
CTGCATAAATTATTTAAATGGGTTAAGAGAAAAAAAACAGAGAAATGGAAGAAAAGCAAA
AAACTGAAGAGTAAAAGAGATTGGAAGAGTTAAAAAAGAGATAAAATCGTCTTAAAAAGA
AAGAATAAATGCTGCTATAAGCTCATTAATAAAAATAAGCTGAAGCTGCTGCTGCAGCAG
CTGCAGCCGCTCTTGCTAATAATGAAGTTTCTGATAAGCCAGTGAATACCAGCGAACCTC
CAAAAATTATTCTTATGAAGAGTTAGAGTTTAAAACCTGAAGAAGGTGCCTCCACAGGAT
CAAATTTAATAAAAATTCCTTTTGATGCCTCATTAGCAAAAATGAGCTCAACTCAATCTT
AACCAAATAGCCAACTTGACATTGGCTACAACTCAAGATAAATTTATGATAAAATTATCC
CTTCAAAACCTAAGAAAACATAAAGCATATAGTAAGAGTAGAATGCAAATACATCAAATA
GTCAAAATTTGAATTTCAATAAAATAAAGATTAATGTTGGAGGATCTCCAGTAATGCCAC
CTGCTAATAACCCATCTATTTAAAATTTTCCTATTCCTTAAATTTCAGTTGGAGGTGAGC
GTGTAGATTTTAAATTTGTTTTAGATAGAAAGGCTCTTAAAAAAGAGTATGAGAACATGA
TAAAAAGAAAACAGTTAAAGTATAAAAAACTGCTGGAACTTAATCTAACAAAAATGTAGA
AAGTAACTAATTGGATGATAAGAGAGTGGGCAAAGTAGAAAAAAGATGTTCGTTCTGAAA
CTTTAGATTATTTTAGAGATATCTTAAATGAAAGATAGAAAATTAAAGATAATCTCGATA
TTCGTAAAATTCAGCTGTTCTTAAAAATGTTTTTATACAGGCTCAGAGATTTCTACAAAG
ATCTCAAGCCTGATTATATTGACAAGCTGAAAAATATTAGTGAAAAGCTATACAGAATTG
GTTCTAGAGCTATTGTATACAAAACTCCACTCTCTATCAGAGATAACCCTAAAAACGCTT
CATTAGATACTTAAGTCAGTAACAACTAGATCTTAGATGAATCTCATCCTTTGAAAAAAT
TGCAAGAGGAAATACTTGAAATAGAAAGAGAAATGAAGCTGTTCCGTCGTATGCTTAGCA
GAGATATCTAGAAATACTAAGAAGTAATTTCAAATCATCTTATCATTTAAATTTTTTGAA
TCATTTTTATCTAATTTAACAAAAATATTTTTAAATTGATTTTTAACAATTTTTTACGAT
TTATTTCATTTAACAAAAGCAGCCAGATGCGACAACTCAAAAGTCTAAAAAATCAAAAAA
CAAAGATGACGGAAGCTAATATAACGGAGGTAATGATAACGATTAGTAAGGAGGATATAT
GAATGGTGGTTAAGGTTATGACGATTCAAAAGATGCAATTTATGGAATGGGAGATAAAGA
TTAGTAATAAAAGTAAAGTGAAATACTGTCATTCTTCTTGGAGTATAACAAAAGCTTTGA
AAAGCACTCCTCTAATTTGCAAAAAATCCAACACTTTTTGGCATATTAAAATTATAGCAA
TATTCTAAATTAATTATAGAGCAAGAATCCAATAAAGAGCGACTAACTATTTGATATATG
CGAGACTTTTGTTGAAGATGAAAATAATAATTAAGTAGAAATTCTTTAATACTTCAAAAA
AAAGAGAAAAATTTCTGAACATACATCTTCAGAAAGTATGACAAATAACAATAATGATAC
AAAGATTGAAGAAGAAGGTAAATAAAAATAGAATGATTAAGAAATCGATGAATTAAATTC
TAATATATTTGACAATGTTACTTTATCTTTTAACTTCAATCTTGACTCTAAGAAAGAAGA
TGAAGAAGGAAAAGAAAACACTTTCATAAGTAAAAGTCAAGACAATTCATTTAATAATCC
AAAATAAGCAATAAATGTATTCAGTTAGTTTGATGATGATGAAGATGATTCTACTGAAGC
AATAATGGAAGAGAGAAAATATTAAGAGTTTAAATCTAAAATAAACTAAAAAAATCTCAA
AGAATGCAATAGTGGAAGTGATATTTTGGGAAAAAATATAAGTGATATAAATATTTCCAA
CGTAATCAACCCAGAGTTTGACTATTTCGGAGTGAAAAAACTCAATTAAATGATTAATAA
CAAAGTTATAAACAAAAAATTCTGCCAAAATATAAACTCATTTATAAAATAGAAATTTTA
AATTGTTGAAATCAACAAAATAAAATGCAAAAATGCTATTATTTACTAAAAAATGAAAAC
AAATGATGATCTAGTTAAAAATTTATATTAAAAATAGTAATTATTAGAGCCAAAGATAAA
TATTAAAATAGCTCCTCCGTTTTTGGATGATCTCAATATTAATTGTTTGCAAACACTAAT
AAATTTATAAATTTAGGTTGAATTGAGACTTGAGAATGAATAAAATCCTAAAAGCTAAAT
GGATATAGAAAATAGCCAAAACAACTAAGCTGAAAAATCTTTAGAATTTCATATTTAAAA
TAATGTTAACTATGCTTGTTGTGCATACTTTACAGAGTTACCCAATATAAAGGATGAAAT
ATAGCTAAATTGTAAAGAAAATGCTGACTTCTATTCGATTCTATGCTAAGAAGATGTAGA
GCAAGTTGTTTAATCATTTAAAATATAGAAACAATTATATAGATTGTTATCGTAAGATAG
CTTCTTAACTTAAGAAGTAATAAATAGTGAGGCAGTTTGTATAACAAAATAAAGATTAAG
ATAAATTGATCCTTAAAACAACAAATTTTTGTTAGAAATTTCTCTCTGGACTCCTACTGA
TAATCTAGGTTATTTATCAATAAAACTAAACAATGAAGAAATATTTTCACCACTCAATTT
TATTTAAAAAATAAAAAAGTTTTAACAATATCAGATTTAACAAAAGCAAATTTAACAACA
ACAACAACAACAATTGTAATAACAACAAAAAAAATATATCTAAAATCAATCACAATGA