Identifiers and Description

Gene Model Identifier

TTHERM_00142380

Standard Name

BroW-1 (Bromodomain and WD40 1)

Aliases

PreTt26644 | 11.m00341 | 3702.m00065

Description

Bromodomain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00142380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04836.19.997093137033517e-262bromodomain containing protein
(2072 aa)
OxytrichaContig9009.0.1.g1054.001416569413617e-37WD domain, G-beta repeat
SGDYMR146C0.000000000007996637300921877TIF34 eIF3i subunit of the cor
e complex of translation initi
ation factor 3 (eIF3), which i
s essential for translation; s
timulates rate of ribosomal sc
anning during translation rein
itiation
WormBaseWBGene000016800.00000019998969434520019locus:gpb-2 Guanine nucleoti
de-binding protein subunit bet
a-2 status:Confirmed UniPr
ot:Q20636 protein_id:CAA9582
4.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10
  2. Ref:27892853: Hamilton EP, Kapusta A, Huvos PE, Bidwell SL, Zafar N, Tang H, Hadjithomas M, Krishnakumar V, Badger JH, Caler EV, Russ C, Zeng Q, Fan L, Levin JZ, Shea T, Young SK, Hegarty R, Daza R, Gujja S, Wortman JR, Birren BW, Nusbaum C, Thomas J, Carey CM, Pritham EJ, Feschotte C, Noto T, Mochizuki K, Papazyan R, Taverna SD, Dear PH, Cassidy-Hanley DM, Xiong J, Miao W, Orias E, Coyne RS (2016) Structure of the germline genome of Tetrahymena thermophila and relationship to the massivel

Sequences

>TTHERM_00142380(coding)
ATGTAGGAAGAAGAAATTATTATGACAAAACACGTAAGCTCAAAAGGCAGAGTGTTTTTT
GATAATCAGAACATGGTTAAACAGCGTCTATATTTTTTGATTATCCAGTACTTATAGCAA
GACGAATATTTTGATAGAAGGCTACTAGAGCAGATTAAAGGCTACGCTGAAGCAAATCAT
TTATTGGGCTAGCTACTGGCATTTGATGGAAGCCACGTAGATGCAACATTTGATGAGTTA
AATTTCTAATAAAAAGGAAGTAGTTGTCATTCTGCACTCTTTTCAAAGGATGAAAATCTT
AATACAATCTTATCTATTTATTAGCGCTTTAGTGCATAGCGCGTAAAAAACTAAAATAAA
GGTATACAGAATTTGTTTATTTAAAAGATGACCAAGCTTTCTTAAATGCTCAATGAGCCT
GCAATGTATATTTAACCAGCTAGAGACTTGTTTATTAAGAAAAAGAGATAAGGTAAGAGC
CTTAAAAATACTGATGAGTTATCCAACGATACATTTATCTTGAGGTTTTAGCATTTAAAA
ACATGTTTTGGTCATGCATATTCTGCTGACTCAGGCTCTATAAATGAGGAGAGTGGTGAA
CCTTACATTCCAATATACAATACAACATTCGATAAGAGCGGACGCCTAGTTATAACTGCA
GACGAAGAAGGATTAATTAAGATTTGGAGTGCTGAGAACGGATTACTTTTGTCAAATTTA
AAAGGTCATACTAGCGGAATTTTGAGCAACGATATATCTCCTTGCAATAAGTATTTAGTA
ACTTGCTCTATAGATTTAACAGCAAGAGTTTGGGATATCTTTAATTAAAGGTGTCTTACT
TGTTTTAAATCAAAAGAATAATTAAATGCTGTTGTTTTCTATAAATATCAAAATGAATTT
ACTGAATAACTCTACCTATTGATGATGAGCAATGTTGGAAATATTCTTATATACAAAGAA
GATTAATTCAAAGAAAATGGAGGTGGTATAAATTAAAATTTGCAGCCAGTTATCACTCTC
GCAATGAGAAAGCACAAAAAAATGCAAGAATCTAAGATAGTTGATAACGATAATAAGAAT
GAAGCTGTTTGCATAGAGACTCACCCATCTGGTTACTTAGTTGTCGGCACTGAAACAGGA
GAAATTTTAGTTTGGGAAAAGATACACACCCTCGAAAATAGAAATCGCTAAGTTCTTCCA
TTCATAGAAAAGAAAGAACATTCTAAGAATTGCTAGCTGATAAAATTCTCACCCAACGGA
GAGTTCATGATCACTGCTTCTTTCGATGGATATGCAAAAATATGGCCTTGGAAAAAGCTG
ATAGAAAACGATAAAAGACTCAGTGATTAAATCTTCTCAATTTATTTTGACAACTCCAAC
AAGTGCGAAAAAAACTGCTGGAATGTAGCATTCAGTTGCAAGAATAGATATGCATTCGCT
ACCTTTACCAGAAAAATGAAGAGGACAAAAGAAGTAGAAACAGTTGTTTATGTACATGAA
CTAGCTGAAAAGAAAATCAAGCATGAGTTTACTCAACAAAATACACCCGCAAGACTTTAA
GATCATATTTTAGTTTTTGAACCCCATCCAACATAAGAAAATATCCTCTTAACAGCAGAT
TACGCAGGTCAAATTATCATCTATGATGTCTCTTTAGGATGTATTTTGAATATATTCTAA
GAAAGGGGATACCATATTGGATATCCTAATCTTGAAGTACCCGTTTTAGATGGTTGTTGG
GCACCAGATGGATTAAAATTCGTCGCAAGTACTTACTATGGCTCTTTTAGCTTGTATGGA
TATGATTGCGCAGAAATATATAAGACTACTCCTACAGAATAATTCTTTGCTAATGACACA
GAGATATTTATATATAGTGATAATCATGTACCACTGTCTACAGATGATGATGTAGAAATT
AATACTAAAAGTAGAGGAAAAATTTGTGATTATTAGAGAATCCCATATAGATTTGAATAT
AATAATGATCTCAAAAAATTAAAAGATAGAGGCTATTTTGAAGAAACATCAGAAATGGCT
TTAAAGTTGATAGAAGATAAAATATCTGAATTAAAAATATTAGAAAATGAATAAAAAGAA
AAAGATGAAAACTTTTCAGAAAATTTAGTTGAAAAATATTTAAAAAACTAAGAAAAAGAG
AAACATGCTTATTTTGCTTTATGTAATTAATTGAGAGACTCCTATAACAATGCAAATGCA
ACTATGGAAGGAAGCATGAGAGTTGATTATAATGAAAGAATGGAAATTCTGAAAAAAATG
TCAAAAGAAATGCAAAAAAGACACTCTTTAGATATTAAGAAAACTGAAACTAAAACTGAT
GAAGATTTGTTTTAATAAGTTATTTAGCAATCGCAACCTAGAATTCTACAAGAAAGATAA
ATTTCTGATCCTGCTCCTGCTCCTCTTCTTAGATAAGAAAGTGAATAGGCTACTCTTATA
TAGTAAAGAAATAATAATAGAAGAAGAGTCATAGACGATGAAGACTTGGATCAAGGACGC
TCAAATACAATACCATTTGGGAATTAATAACTAAGTAGAAGGCCTAGCTAAATGCCTTAA
CCAGCTGCTTTAAATAATTAAAATTCAAGAACTGGATAGCGCGGAAGAGGAAGAAGACCA
GGTGGTAGATAGAGTAATACTAATTAGGTTGGATTCAATGATGACTTTGAAGACTCTATG
CAATCTGAGGAAGAGATACCGAGTTAAGATGATAGTGAGGTAAATTTCAAAGACATAAAT
GAAGATGATGATGAAATTTAAAAAGATTTACTTGAAGAAATGGAGATGTTTGATGATCCT
TTGCCTAGAAGAACTGGGGGAGGGTTCGAAAGTAATGACAGAAGAAACTAATCTAATAAT
AGAAATAGATCAAGAGGAGGAAGGAGAATCGTGGCTGATGACTATTTAGATGAAGAGGAA
GAAGAGAAAAAGGATTCTTCAAATTAGAGAAGAACACGCTTGAAAAGATTTTCTAATACG
ACTTCAAATGAAACAAGAGCACAAACCATAAGCCAGTAATAAACAGAAGGATAGCAGCGC
TAAGGTACATTAAGATATAATAGGAATACGAGAAGTAGTTATAGTATGTAGTATACTACT
GGAGAAGATGCTACTCTCTAATCTAATGCAGGATATAATAGCAGCTAAGATTATGAAGGT
AACACAAACACAAGATTGAGAAGGAGAAATCAACACATCATCGAAGAGGACAATGATGAT
TTATACTTAGACAATAATACTAATAGCAATAACCATCATTCTTTGAGATAGAATAACTCT
TCTCATTTATAATAATCTCATAATTTGGCTGAAACAAGAGCTAATGCACATCAAACTAGA
AGCTCAACTGCGACATATTAAGATTCACAAAATAATACAAAGACTCTCAGAGCTTCATCA
AGAAATAAAAAGAGCAAGAAAAATAGATAATATAATGACGGCTTTAACAGCAACGATAGT
GAGTCTGAAGATAGGTTTTCAGATGAAATCATGGAAGAAGATGACGATGAAGTTGATATT
AATTATGAGGACGAGGATGATTATGAATATAAGTTGAGGAAACCAAAAAAATCAGTAGGC
GGTGCTTAATCTTTATCATAAAATAACTAAAATTCAAGATAGAGTGGTCGTTCGCTTCGT
ACTTCATACACAAACAGAAAAAAAATTTAAGATTCTGATGAAGAAGAAGATGAATTACCA
AAGTAAAAAAACAGAAGCAGTAAAAAGAATGGTATTGTTAATGACGAGGATGATAACCAA
GTTTAAAATGAGCATAAAAACATAGAGAAGCATAAAATCTATGATAATGATGAAGATGAA
GAAATAGATGACTTTGATGAAGAGGACGAAGAATACACTGACAAGAAGAAGAAAAATTAC
TTGAAAAAAAGAACTTCATCAGAAGCTGGTATTAAGAAAAGTGGTTAAAGTAGTAATAAA
TTAGTTAAAAAAATAAAAACTAACGACTCTGATGCGCTTAATGAAGATATGGCATCAATG
CCTGAAGATAAAAAATCTCTTTGCTAAAGATGTGAGCAAATTATTGAGGGAGAAGCAAAA
TCTTGCAATATTTGCAAACATGCTTACCATGATGAGTATTGCAGTAAATATAGAGGATGT
TTGAAAGATAAAAAGTACTTTTGTTTTGACTGTTATGCTAATAATAACACAGTACGTATA
CAGAAAGACGAATAAGATAAAAGAACTTTCAGCAGAGAGTACCTAGAAAGAGAAACAAAC
GATCCTTACCAATATATTCCATAAATAAATGACATGTGTTATTACATCTTCTAGGCTCAT
GAAGAGTACTGTGAAAAATATTTCGAAATCTTTGATTACGAACCATTGATTGACAGACTA
TAAAAAGAAAATGAAAAATCTCTTTAAAATGGAAATAATAAGTCTACAAAAAAAAGTATC
CAAAGGTCCTCTAAATTGATAGACAGTGGTGATGAATTTCAAGGAGATGAGCATTCTTCT
AACTTTTAAAAGAAAGGTTAGACATCTTAAGCTTAAGATTATCATATTCTACCATTTTTA
AGTTACAAAGAGCTCTATAAGCCAACCTTATGTCAAATAAGCTCTATCGAATACTCCTAT
CCTATGTTAAGCACAAAAAAGATGCAAGAAAAATATAGAGAAAGACCTATATTCTTACTT
ATTCAGCTCAAAATTTTAGAAACAGGAGAAGAATTCTCAGTTTATTTTTCAAATTCTTAA
GTTTAATGTGGAAGTTTCTTGATTCCTTAGGAATTATATGATTAGTCAATTTGCTTCTAA
GAAAACCTTAAGGTACCTCAGTAATTAGAATTCTTTTACCATAATTAAGTATTCAGCGGT
TAAGTGGTTGAAGTGTCACCAAAAGAAGAATATTAAAAGTTGAATTCTGAGTACTTGAAG
CTTAAAGTCAAATTAGATACAACAGATGAAAAAATTATACAAAAGTTAAAATAAAATTTA
GAAGGGCCTAATATGATTAGAATCTCTTGCTGGGATGTCATATATCCAATCAGAAGAACA
TCCTCTCCTGATGACTATCCAAACGATGACGCATGTCTTTCTAAGGAAGAAACAGAATAA
ATTTTTAAGCTAATTTAAGCAGTAATTGATAATCAAAGTGAAATAACTTGCTATTTTGAA
GAAGCTGTCAACTTAAAGAAATATAAACATTATTATGAATTTGTTGAATTCCCAATGGAT
ATTTCAAAAATTAGAAGAAGACTATTAAACGGATACTATCGTTCTCAACAAAGCATATTT
CATGATATAAACTTGATAGATTCGAATGCTCATAAATTTAATAATCCTGATAGTCCTATC
TGTGAGAGTTCGAAGAGAGTTAAAGAAATATTAACTTCGATTGTAAGCAATTTCCTAAAC
GTAGAAATGTGTTTATCTCTAGCAATAAAAAATAAAAAAAATCTAATAAAAACTATTTAA
ACTCTGTTCCCCAACTACAATACTAACTCCAACTAAAACAATTTATCAATAAATAATAAT
AACATTTAAATAAAGATTCCTTAATAATCTTAATAAAGTTTAATACCTGTACCAATAGAA
AAACCTCACGCTCTAATTAACAATCCTCTACTTTAGGCAGAACAATATTAATAAAAATAT
CCTAACTCTCAAGTAGCATATAATGCAATCCAACAATAAAAACCTCAACAAAATTATAAT
TAAATTAACAATAATTTTAATCAATAAAATTAATAATACCAGTATAATAATTCCGCATAT
CAAAATAACTCTAACAGTAATGATACTTATTTTAACCAACAAAATGCTAATTAAAATGGT
TAACCTTATGCAGTTACTGGTTTAATAAACGAACCTAGCAACTAATACTTTAATAATCAA
CAGAGCTAGATTAATTAAGATTTGAATTATAATTCTTAGTTATACGAACCCATTAATAAT
GCAGATAATAATTATAGTTAAACTAATTATAATTATGAGGCAAATTAAGGATATGATATA
AACTAAAATGTGAATTAAGATTACTAATTAAACGAATTCTAATCTTAAAATTTAGGATAG
CAAAATGTTTAATAAAATATTCCTAATTTACAATCACAGTAACAACAAAGAACTACTAGG
AGTGGAAGATTAACTAGAAATTCCTCAAAGTTCGACTATGATTAAATAGATTAAAGAAAA
AATTGA


>TTHERM_00142380(protein)
MQEEEIIMTKHVSSKGRVFFDNQNMVKQRLYFLIIQYLQQDEYFDRRLLEQIKGYAEANH
LLGQLLAFDGSHVDATFDELNFQQKGSSCHSALFSKDENLNTILSIYQRFSAQRVKNQNK
GIQNLFIQKMTKLSQMLNEPAMYIQPARDLFIKKKRQGKSLKNTDELSNDTFILRFQHLK
TCFGHAYSADSGSINEESGEPYIPIYNTTFDKSGRLVITADEEGLIKIWSAENGLLLSNL
KGHTSGILSNDISPCNKYLVTCSIDLTARVWDIFNQRCLTCFKSKEQLNAVVFYKYQNEF
TEQLYLLMMSNVGNILIYKEDQFKENGGGINQNLQPVITLAMRKHKKMQESKIVDNDNKN
EAVCIETHPSGYLVVGTETGEILVWEKIHTLENRNRQVLPFIEKKEHSKNCQLIKFSPNG
EFMITASFDGYAKIWPWKKLIENDKRLSDQIFSIYFDNSNKCEKNCWNVAFSCKNRYAFA
TFTRKMKRTKEVETVVYVHELAEKKIKHEFTQQNTPARLQDHILVFEPHPTQENILLTAD
YAGQIIIYDVSLGCILNIFQERGYHIGYPNLEVPVLDGCWAPDGLKFVASTYYGSFSLYG
YDCAEIYKTTPTEQFFANDTEIFIYSDNHVPLSTDDDVEINTKSRGKICDYQRIPYRFEY
NNDLKKLKDRGYFEETSEMALKLIEDKISELKILENEQKEKDENFSENLVEKYLKNQEKE
KHAYFALCNQLRDSYNNANATMEGSMRVDYNERMEILKKMSKEMQKRHSLDIKKTETKTD
EDLFQQVIQQSQPRILQERQISDPAPAPLLRQESEQATLIQQRNNNRRRVIDDEDLDQGR
SNTIPFGNQQLSRRPSQMPQPAALNNQNSRTGQRGRGRRPGGRQSNTNQVGFNDDFEDSM
QSEEEIPSQDDSEVNFKDINEDDDEIQKDLLEEMEMFDDPLPRRTGGGFESNDRRNQSNN
RNRSRGGRRIVADDYLDEEEEEKKDSSNQRRTRLKRFSNTTSNETRAQTISQQQTEGQQR
QGTLRYNRNTRSSYSMQYTTGEDATLQSNAGYNSSQDYEGNTNTRLRRRNQHIIEEDNDD
LYLDNNTNSNNHHSLRQNNSSHLQQSHNLAETRANAHQTRSSTATYQDSQNNTKTLRASS
RNKKSKKNRQYNDGFNSNDSESEDRFSDEIMEEDDDEVDINYEDEDDYEYKLRKPKKSVG
GAQSLSQNNQNSRQSGRSLRTSYTNRKKIQDSDEEEDELPKQKNRSSKKNGIVNDEDDNQ
VQNEHKNIEKHKIYDNDEDEEIDDFDEEDEEYTDKKKKNYLKKRTSSEAGIKKSGQSSNK
LVKKIKTNDSDALNEDMASMPEDKKSLCQRCEQIIEGEAKSCNICKHAYHDEYCSKYRGC
LKDKKYFCFDCYANNNTVRIQKDEQDKRTFSREYLERETNDPYQYIPQINDMCYYIFQAH
EEYCEKYFEIFDYEPLIDRLQKENEKSLQNGNNKSTKKSIQRSSKLIDSGDEFQGDEHSS
NFQKKGQTSQAQDYHILPFLSYKELYKPTLCQISSIEYSYPMLSTKKMQEKYRERPIFLL
IQLKILETGEEFSVYFSNSQVQCGSFLIPQELYDQSICFQENLKVPQQLEFFYHNQVFSG
QVVEVSPKEEYQKLNSEYLKLKVKLDTTDEKIIQKLKQNLEGPNMIRISCWDVIYPIRRT
SSPDDYPNDDACLSKEETEQIFKLIQAVIDNQSEITCYFEEAVNLKKYKHYYEFVEFPMD
ISKIRRRLLNGYYRSQQSIFHDINLIDSNAHKFNNPDSPICESSKRVKEILTSIVSNFLN
VEMCLSLAIKNKKNLIKTIQTLFPNYNTNSNQNNLSINNNNIQIKIPQQSQQSLIPVPIE
KPHALINNPLLQAEQYQQKYPNSQVAYNAIQQQKPQQNYNQINNNFNQQNQQYQYNNSAY
QNNSNSNDTYFNQQNANQNGQPYAVTGLINEPSNQYFNNQQSQINQDLNYNSQLYEPINN
ADNNYSQTNYNYEANQGYDINQNVNQDYQLNEFQSQNLGQQNVQQNIPNLQSQQQQRTTR
SGRLTRNSSKFDYDQIDQRKN


>TTHERM_00142380(gene)
ATGTAGGAAGAAGAAATTATTATGACAAAACACGTAAGCTCAAAAGGCAGAGTGTTTTTT
GATAATCAGAACATGGTTAAACAGCGTCTATATTTTTTGATTATCCAGTACTTATAGCAA
GACGAATATTTTGATAGAAGGCTACTAGAGCAGATTAAAGGCTACGCTGAAGCAAATCAT
TTATTGGGCTAGCTACTGGCATTTGATGGAAGCCACGTAGATGCAACATTTGATGAGTTA
AATTTCTAATAAAAAGGAAGTAGTTGTCATTCTGCACTCTTTTCAAAGGATGAAAATCTT
AATACAATCTTATCTATTTATTAGCGCTTTAGTGCATAGCGCGTAAAAAACTAAAATAAA
GGTATACAGAATTTGTTTATTTAAAAGATGACCAAGCTTTCTTAAATGCTCAATGAGCCT
GCAATGTATATTTAACCAGCTAGAGACTTGTTTATTAAGAAAAAGAGATAAGGTAAGAGC
CTTAAAAATACTGATGAGTTATCCAACGATACATTTATCTTGAGGTTTTAGCATTTAAAA
ACATGTTTTGGTCATGCATATTCTGCTGACTCAGGCTCTATAAATGAGGAGAGTGGTGAA
CCTTACATTCCAATATACAATACAACATTCGATAAGAGCGGACGCCTAGTTATAACTGCA
GACGAAGAAGGATTAATTAAGATTTGGAGTGCTGAGAACGGATTACTTTTGTCAAATTTA
AAAGGTCATACTAGCGGAATTTTGAGCAACGATATATCTCCTTGCAATAAGTATTTAGTA
ACTTGCTCTATAGATTTAACAGCAAGAGTTTGGGATATCTTTAATTAAAGGTGTCTTACT
TGTTTTAAATCAAAAGAATAATTAAATGCTGTTGTTTTCTATAAATATCAAAATGAATTT
ACTGAATAACTCTACCTATTGATGATGAGCAATGTTGGAAATATTCTTATGTAAATATTT
AAACATCATTTTTATTTTAATCTTTCCCTATTTTTTCAATATTTTTCCAGTGATTTTTCC
TCTTCAAAAACTAAAAAAATGACCTGGATCCCAAAATATTTGATCTTAATCAGCCATTTT
AATTTAGAATTTAGTTTGTTTAATTCTACTTTTTGATTAGCACTTCTATGCCAGCTTCAG
AAAATTTAGATTTATTTCAAAATACACAATTCAATTTAAACAATCAAATATTAATGAACG
GATAGAAATTTATTAGTATTGATTGCAATTTGCCCGCAGCGCAGTAAAAAATCAAATTTA
TGAATAAAAAAAAAGAAAATATTAATTTAGTTAGTTATTATTTATTTCTAAAGAATTAAA
TTAAGGATTTTGGTTGGTTGGTTATTAAAAAAGATTAATTGATTCATATCTATATTTCAA
AAATCAAAATTTGTTTTTAAAAATAATATTAATCAAAAATATAGATACAAAGAAGATTAA
TTCAAAGAAAATGGAGGTGGTATAAATTAAAATTTGCAGCCAGTTATCACTCTCGCAATG
AGAAAGCACAAAAAAATGCAAGAATCTAAGATAGTTGATAACGATAATAAGAATGAAGCT
GTTTGCATAGAGACTCACCCATCTGGTTACTTAGTTGTCGGCACTGAAACAGGAGAAATT
TTAGTTTGGGAAAAGATACACACCCTCGAAAATAGAAATCGCTAAGTTCTTCCATTCATA
GAAAAGAAAGAACATTCTAAGAATTGCTAGCTGATAAAATTCTCACCCAACGGAGAGTTC
ATGATCACTGCTTCTTTCGATGGATATGCAAAAATATGGCCTTGGAAAAAGCTGATAGAA
AACGATAAAAGACTCAGTGATTAAATCTTCTCAATTTATTTTGACAACTCCAACAAGGTA
GAATTATTAGATTTTCATCTTTAATCTTCGTCTTTATTTTTATGCGCCAATAATTAACAA
TTCAAGTTAAATAAAGATTTTTATATCATTTATCAAATATAACAAAAGAGAGTTTTAATT
AAAACTAACAAACTAACTAACAGCTAGTTTATCACTCTTTGTTTTCAAAATTTAATTAAT
TTCATTTTCATCAAACATTTATTTGACTCATTTATTATTTTTCATAATGAAGGAAGATAT
GATTATAATAATGATGTCTTCTACTCAATTTTTTCAACAAATTATTTCTACTTTTGATGC
TTTTGTTTATGTTTTACTTAATTTTATAATTTTTTTAAAAAGTGCGAAAAAAACTGCTGG
AATGTAGCATTCAGTTGCAAGAATAGATATGCATTCGCTACCTTTACCAGAAAAATGAAG
AGGACAAAAGAAGTAGAAACAGTTGTTTATGTACATGAACTAGCTGAAAAGAAAATCAAG
CATGAGTTTACTCAACAAAATACACCCGCAAGACTTTAAGATCATATTTTAGTTTTTGAA
CCCCATCCAACATAAGAAAATATCCTCTTAACAGCAGATTACGCAGGTCAAATTATCATC
TATGATGTCTCTTTAGGATGTATTTTGAATATATTCTAAGAAAGGGGATACCATATTGGA
TATCCTAATCTTGAAGTACCCGTTTTAGATGGTAATCTTTTGTTTAATTAAAAAAGAAAT
ATTAAATTTTTAAATTAATTTTGGTCTTTTATTTTTGATTTATTTATTTAAATGATCAGT
AATAAATAAAATTGCATTTTAAATTTTCTAAAAATCAATCCTATCTACTGCTTTTTTCTT
TGCTCTAAAATAAATAAACATTAAAACTAGTAATAATTAGCAAATAAACACTAAAAGAGC
AAAAATAAAATTTATCAGTTACGAACATTTACTTGTTAATTTAATTTTACCGCAAGTGAG
TTAGTTTATTTTTTTTTAAGTAGAAATGATTGATGGATTAAATATAAATTTTTTTATTAG
AATAATTAATTATTCGGTTTCTATTGTTGGATAAAATATTTTTCAAAATTAATAAAAAAA
ATTATTTTTTAAAATAAATAATTAGGTTGTTGGGCACCAGATGGATTAAAATTCGTCGCA
AGTACTTACTATGGCTCTTTTAGCTTGTATGGATATGATTGCGCAGAAATATATAAGACT
ACTCCTACAGAATAATTCTTTGCTAATGACACAGAGATATTTATATATAGTGATAATCAT
GTACCACTGTCTACAGATGATGATGTAGAAATTAATACTAAAAGTAGAGGAAAAATTTGT
GATTATTAGAGAATCCCATATAGATTTGAATATAATAATGATCTCAAAAAATTAAAAGAT
AGAGGCTATTTTGAAGAAACATCAGAAATGGCTTTAAAGTTGATAGAAGATAAAATATCT
GAATTAAAAATATTAGAAAATGAATAAAAAGAAAAAGATGAAAACTTTTCAGAAAATTTA
GTTGAAAAATATTTAAAAAACTAAGAAAAAGAGAAACATGCTTATTTTGCTTTATGTAAT
TAATTGAGAGACTCCTATAACAATGCAAATGCAACTATGGAAGGAAGCATGAGAGTTGAT
TATAATGAAAGAATGGAAATTCTGAAAAAAATGTCAAAAGAAATGCAAAAAAGACACTCT
TTAGATATTAAGAAAACTGAAACTAAAACTGATGAAGATTTGTTTTAATAAGTTATTTAG
CAATCGCAACCTAGAATTCTACAAGAAAGATAAATTTCTGATCCTGCTCCTGCTCCTCTT
CTTAGATAAGAAAGTGAATAGGCTACTCTTATATAGTAAAGAAATAATAATAGAAGAAGA
GTCATAGACGATGAAGACTTGGATCAAGGACGCTCAAATACAATACCATTTGGGAATTAA
TAACTAAGTAGAAGGCCTAGCTAAATGCCTTAACCAGCTGCTTTAAATAATTAAAATTCA
AGAACTGGATAGCGCGGAAGAGGAAGAAGACCAGGTGGTAGATAGAGTAATACTAATTAG
GTTGGATTCAATGATGACTTTGAAGACTCTATGCAATCTGAGGAAGAGGTAAAATTTTTA
AAATTCAAATAATATCTTTAAACAATAAATAATAATTAAAGATACCGAGTTAAGATGATA
GTGAGGTAAATTTCAAAGACATAAATGAAGATGATGATGAAATTTAAAAAGATTTACTTG
AAGAAATGGAGATGTTTGATGATCCTTTGCCTAGAAGAACTGGGGGAGGGTTCGAAAGTA
ATGACAGAAGAAACTAATCTAATAATAGAAATAGATCAAGAGGAGGAAGGAGAATCGTGG
CTGATGACTATTTAGATGAAGAGGAAGAAGAGAAAAAGGATTCTTCAAATTAGAGAAGAA
CACGCTTGAAAAGATTTTCTAATACGACTTCAAATGAAACAAGAGCACAAACCATAAGCC
AGTAATAAACAGAAGGATAGCAGCGCTAAGGTACATTAAGATATAATAGGAATACGAGAA
GTAGTTATAGTATGTAGTATACTACTGGAGAAGATGCTACTCTCTAATCTAATGCAGGAT
ATAATAGCAGCTAAGATTATGAAGGTAACACAAACACAAGATTGAGAAGGAGAAATCAAC
ACATCATCGAAGAGGACAATGATGATTTATACTTAGACAATAATACTAATAGCAATAACC
ATCATTCTTTGAGATAGAATAACTCTTCTCATTTATAATAATCTCATAATTTGGCTGAAA
CAAGAGCTAATGCACATCAAACTAGAAGCTCAACTGCGACATATTAAGATTCACAAAATA
ATACAAAGACTCTCAGAGCTTCATCAAGAAATAAAAAGAGCAAGAAAAATAGATAATATA
ATGACGGCTTTAACAGCAACGATAGTGAGTCTGAAGATAGGTTTTCAGATGAAATCATGG
AAGAAGATGACGATGAAGTTGATATTAATTATGAGGACGAGGATGATTATGAATATAAGT
TGAGGAAACCAAAAAAATCAGTAGGCGGTGCTTAATCTTTATCATAAAATAACTAAAATT
CAAGATAGAGTGGTCGTTCGCTTCGTACTTCATACACAAACAGAAAAAAAATTTAAGATT
CTGATGAAGAAGAAGATGAATTACCAAAGTAAAAAAACAGAAGCAGTAAAAAGAATGGTA
TTGTTAATGACGAGGATGATAACCAAGTTTAAAATGAGCATAAAAACATAGAGAAGCATA
AAATCTATGATAATGATGAAGATGAAGAAATAGATGACTTTGATGAAGAGGACGAAGAAT
ACACTGACAAGAAGAAGAAAAATTACTTGAAAAAAAGAACTTCATCAGAAGCTGGTATTA
AGAAAAGTGGTTAAAGTAGTAATAAATTAGTTAAAAAAATAAAAACTAACGACTCTGATG
CGCTTAATGAAGATATGGCATCAATGCCTGAAGATAAAAAATCTCTTTGCTAAAGATGTG
AGCAAATTATTGAGGGAGAAGCAAAATCTTGCAATATTTGCAAACATGCTTACCATGATG
AGTATTGCAGTAAATATAGAGGATGTTTGAAAGATAAAAAGTACTTTTGTTTTGACTGTT
ATGCTAATAATAACACAGTACGTATACAGAAAGACGAATAAGATAAAAGAACTTTCAGCA
GAGAGTACCTAGAAAGAGAAACAAACGATCCTTACCAATATATTCCATAAATAAATGACA
TGTGTTATTACATCTTCTAGGCTCATGAAGAGTACTGTGAAAAATATTTCGAAATCTTTG
ATTACGAACCATTGATTGACAGACTATAAAAAGAAAATGAAAAATCTCTTTAAAATGGAA
ATAATAAGTCTACAAAAAAAAGTATCCAAAGGTCCTCTAAATTGATAGACAGTGGTGATG
AATTTCAAGGAGATGAGCATTCTTCTAACTTTTAAAAGAAAGGTTAGACATCTTAAGCTT
AAGATTATCATATTCTACCATTTTTAAGTTACAAAGAGCTCTATAAGCCAACCTTATGTC
AAATAAGCTCTATCGAATACTCCTATCCTATGTTAAGCACAAAAAAGATGCAAGAAAAAT
ATAGAGAAAGACCTATATTCTTACTTATTCAGCTCAAAATTTTAGAAACAGGAGAAGAAT
TCTCAGTTTATTTTTCAAATTCTTAAGTTTAATGTGGAAGTTTCTTGATTCCTTAGGAAT
TATATGATTAGTCAATTTGCTTCTAAGAAAACCTTAAGGTACCTCAGTAATTAGAATTCT
TTTACCATAATTAAGTATTCAGCGGTTAAGTGGTTGAAGTGTCACCAAAAGAAGAATATT
AAAAGGTAATTAATTAATTATTTCATTAATTAAAATATATTTCAAAATAATTTATTTTAT
AATAGTTGAATTCTGAGTACTTGAAGCTTAAAGTCAAATTAGATACAACAGATGAAAAAA
TTATACAAAAGTTAAAATAAAATTTAGAAGGGCCTAATATGATTAGAATCTCTTGCTGGG
ATGTCATATATCCAATCAGAAGAACATCCTCTCCTGATGACTATCCAAACGATGACGCAT
GTCTTTCTAAGGAAGAAACAGAATAAATTTTTAAGCTAATTTAAGCAGTAATTGATAATC
AAAGTGAAATAACTTGCTATTTTGAAGAAGCTGTCAACTTAAAGAAATATAAACATTATT
ATGAATTTGTTGAATTCCCAATGGATATTTCAAAAATTAGAAGAAGACTATTAAACGGAT
ACTATCGTTCTCAACAAAGCATATTTCATGATATAAACTTGATAGATTCGAATGCTCATA
AATTTAATAATCCTGATAGTCCTATCTGTGAGAGTTCGAAGAGAGTTAAAGAAATATTAA
CTTCGATTGTAAGCAATTTCCTAAACGTAGAAATGTGTTTATCTCTAGCAATAAAAAATA
AAAAAAATCTAATAAAAACTATTTAAACTCTGTTCCCCAACTACAATACTAACTCCAACT
AAAACAATTTATCAATAAATAATAATAACATTTAAATAAAGATTCCTTAATAATCTTAAT
AAAGTTTAATACCTGTACCAATAGAAAAACCTCACGCTCTAATTAACAATCCTCTACTTT
AGGCAGAACAATATTAATAAAAATATCCTAACTCTCAAGTAGCATATAATGCAATCCAAC
AATAAAAACCTCAACAAAATTATAATTAAATTAACAATAATTTTAATCAATAAAATTAAT
AATACCAGTATAATAATTCCGCATATCAAAATAACTCTAACAGTAATGATACTTATTTTA
ACCAACAAAATGCTAATTAAAATGGTTAACCTTATGCAGTTACTGGTTTAATAAACGAAC
CTAGCAACTAATACTTTAATAATCAACAGAGCTAGATTAATTAAGATTTGAATTATAATT
CTTAGTTATACGAACCCATTAATAATGCAGATAATAATTATAGTTAAACTAATTATAATT
ATGAGGCAAATTAAGGATATGATATAAACTAAAATGTGAATTAAGATTACTAATTAAACG
AATTCTAATCTTAAAATTTAGGATAGCAAAATGTTTAATAAAATATTCCTAATTTACAAT
CACAGTAACAACAAAGAACTACTAGGAGTGGAAGATTAACTAGAAATTCCTCAAAGTTCG
ACTATGATTAAATAGATTAAAGAAAAAATTGA