Identifiers and Description

Gene Model Identifier

TTHERM_000446029

Standard Name

BrEt-3 (Bromodomain and ET domain 3)

Aliases

None

Description

bromodomain domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_000446029

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10847.19.997093137033517e-262hypothetical protein (677 aa)
OxytrichaContig18994.0.g682.0004286606204839e-16Bromodomain
SGDYGR252W4.999617891954556e-16GCN5 Acetyltransferase, modifi
es N-terminal lysines on histo
nes H2B and H3; acetylates Rsc
4p, a subunit of the RSC chrom
atin-remodeling complex, alter
ing replication stress toleran
ce; catalytic subunit of the A
DA and SAGA histone acetyltran
sferase complexes; founding me
mber of the Gcn5p-related N-ac
etyltransferase superfamily; m
utant displays reduced transcr
iption elongation in the G-les
s-based run-on (GLRO) assay
Stentor CoeruleusSteCoe_268400.000000000000001713908431542013
DictyBaseDDB_G02938000.00000000000001000191320216021DDB_G0293800 on chromosome: 6
position 3334534 to 3337072
WormBaseWBGene000174230.000000000000020000882446601127status:Confirmed UniProt:O76
561 protein_id:CCD69431.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_000446029(coding)
ATGGATAACTTAAATAGTAACCAGATAAATACTCAGAACAACACCACTGTTGAGTTCTTC
TTATCTTCAGAGTAATAAAGAATCATAAATGAATTGCTCCCAAAGGGATACTCTCTCTAG
TTCGCTTCCAAGCCAGCCAGATCTAAATCAGGCAGCTTTACCAAAACTATTGCTTAATTT
GGTCGTTAAAATGATGGATAATTAAGAAACTCAAACGGCTAATTCGCTCCTTCCTCTAAA
GCTTCTAAAAAATATGGAACAGGAAAGTTAGCATCATAGGAAGGATATGCTGTCCCTTCG
TTAAGCTACTAAGGAATTAATTAAGCAGCTTATCCTCCTATGCAAGGAAACGGATCAAAT
TAAAATAACAATGGAATGAATACTCCTCAATTAAATAGTTAATCTTCTTAAATTTAGGGC
TAATATAACTAAATCCCTAACTTGAATTAAAGCTAATCTCAAGTCAACTAATAATCTGGT
TTAAATCAGCAATACTCTCAAAACAATAATTAACTTGGATATTAACAGTAATAGCAAATT
TAGCAATAAGCATAAATGAATTAAGGAGTATAGATGAACAATATGCAAATGTAGTAGTAA
TAAATGAACTAAGGAGGAGCCATGTATGGTCAAAACCAAAATAATGACTATTATCAAATG
CAATAATAGAATTCCTCTTAGTATTAAACTTCAGATCAAATTCGTATGAATTAATAAATG
TAATAACCAGATATTTACAACTAACACTTAATCCACATGAAGCCTACTGGTTAACGTAAG
AACACTGTCAGCAAACCTCGCAAAGAAAAAAAACTCAAGCAAAATGAAAAAGCTCAAAAA
TTAAATAAAAGAAAGAGCGATGCAAGTCTTGCTGCTAAAGTCTCAAAGAAGTAAAGAGCT
CTTATGGCTGCTGTTGGAAATGAAGAAATCAGCTATGGAGGTATGCATCCTGTAGAATAA
AAGAAGTGCTTACACATTCTACACTCTCTACAAAAGCACAAATCTTCAAAGCCTTTCTTG
AAACCAGTTGACCCAATAAAAGAAGGATGTCCTGATTATTACATGGTTATCCGCGAACCA
ATGGATTTATCTACTGTTGAAAAAAATCTGAAAGCTCATCTATACTAATCCCCAACATAA
TTTGCTGCTGATATCCACAAGATTTGGAAAAATAGCTTTATTTACAACAATCGTGACTCT
TAAATATATAACATGACTCTTGAAATGGAAAAATATTTCAGCAGAAAGTTCAAAGAAATT
GAAACTAACTTGTATACCAAGACTGATGGAAGAACTTCTACAACTGACATCATTTAGGCA
TTAACAGGCTTCTTAACCTAGAACTAAAAAGGTACAAAGAAAAACAAAATAGCTGGTCTT
TAACCTATCCAAGTCCCCCTAACATCAGCTCCTTAACCCACCAAAAAGACTAAAAATCCT
ACCTCAAAAATGGATATTCCCATGACAATGTAAGAAAAAAAGAATCTCGGACAAAACATT
TTATTACTCCCACCTGAATGTTTACGTGGAGTTTGGGAGATTGTATAATCTGATGGAAAC
TAGCAGTATGACGACAAAATACTCACCTTTGACATTGATGCTCTATCAGTTCGTAAAACT
CGTGAATTAGAATAGTATGTCAAGCAAAACATGGCTGCCAACAACAAAAGACTCTCCAAG
AAGTAAGCAAAAATCCAAGAAAAGTCCATGAATGCTGACTAAAAGCTTATCTAAAATTCA
ACATTCGGTTAAGATGACGAAACTGCAGCTACTCATCATGAAACAGTTATTGTTTAAGAT
ATGACTTAGAGCACAATTCAGCACACACAATAGTATCAAGTTCCTATGCACCCAAGCTAA
TATCAAATGGAGCAAATGCACACCTAAACCATTGGATCTTATGGAAATGGATAGACAGAG
TATGCCTAACATCAACATGATATGAATTAGGGAATGGATGAATAAGGAGATATCAACGAT
ATAGATTCAGACTCATCTAACATTAGTGACAATGACAGTGACAGTCAATTCAATTGA


>TTHERM_000446029(protein)
MDNLNSNQINTQNNTTVEFFLSSEQQRIINELLPKGYSLQFASKPARSKSGSFTKTIAQF
GRQNDGQLRNSNGQFAPSSKASKKYGTGKLASQEGYAVPSLSYQGINQAAYPPMQGNGSN
QNNNGMNTPQLNSQSSQIQGQYNQIPNLNQSQSQVNQQSGLNQQYSQNNNQLGYQQQQQI
QQQAQMNQGVQMNNMQMQQQQMNQGGAMYGQNQNNDYYQMQQQNSSQYQTSDQIRMNQQM
QQPDIYNQHLIHMKPTGQRKNTVSKPRKEKKLKQNEKAQKLNKRKSDASLAAKVSKKQRA
LMAAVGNEEISYGGMHPVEQKKCLHILHSLQKHKSSKPFLKPVDPIKEGCPDYYMVIREP
MDLSTVEKNLKAHLYQSPTQFAADIHKIWKNSFIYNNRDSQIYNMTLEMEKYFSRKFKEI
ETNLYTKTDGRTSTTDIIQALTGFLTQNQKGTKKNKIAGLQPIQVPLTSAPQPTKKTKNP
TSKMDIPMTMQEKKNLGQNILLLPPECLRGVWEIVQSDGNQQYDDKILTFDIDALSVRKT
RELEQYVKQNMAANNKRLSKKQAKIQEKSMNADQKLIQNSTFGQDDETAATHHETVIVQD
MTQSTIQHTQQYQVPMHPSQYQMEQMHTQTIGSYGNGQTEYAQHQHDMNQGMDEQGDIND
IDSDSSNISDNDSDSQFN


>TTHERM_000446029(gene)
ATGGATAACTTAAATAGTAACCAGGTATTTAATTAAAATTAAAATTATTTCTCCTCTTTT
ATTTTCTCTTTCTTTTCATATTTATATTTATTCGCTCAAGCTTTTCATATAATCCAAACA
TATTGTTTATAGTAAGTTAATTAGTTAGTAGTTAGTTAGTTAGTTAGTTAGTAAAAAAGC
AAATAAGTAAAAAAGTTAGAAAAAATAAATAAATAAGTTAGTGGTTAGTTAGCAAATAAG
TAAGCGAATGAGCTATTTCCACCTACGCATCCAACATCTAACAATATACTTTCATACTAA
TAGTTTTATTGTTTATCATTAAGTTAGTAGTAGCTCCTCTCAAACTATAAATCCATCTCA
AATTCCTACACTTCAAATTGTCTTTAAAAATTTTTAATAAATATAAAGCTCTCTTTAATA
ATTATTTTATCTTAAAATATTTCAATTTCAATTGCGTAAAATAGTTATTTACATTCAAAG
GCTTCCATTTATGCATGTAATCAAATCGTTGGTCTTTCTCTAAATTGTCTTTTATATGAA
TGAGAGTTCATTCATAAGTAGTTTAGGTTGATATATATCTTGTCTTTAGTAAGATTCTAC
TTAACGCTAAGCTATATCGAAGTAGTTGCACATTTTCAAGCAGCAAGCAAGCATGTAGAA
TTAAATAGACACTAAAATTATTTAGATAGTTATATATATTATAAAGCATTCAAAAAACAA
GAAGCTCACTTTTTCTAAGAAGTCCTTCAAAGATTCTAAAGATGATATTCAAATTATAAT
AAATTAGGTTAAAATTAAAGTTGTGTAGGATATGATGGTAGTTATGCTGAGAGAGAGTTT
TTTATGAAAATTCTATGGTTTTCTTTTTTAAAAATGCGAAATTATTTAAATTAGAATTAA
AATAGCTAAGCTAATTAACTAATTAACAAACTAACTAAGTAACGCGATTTTGAGTTTTCT
ACATAGAGTTAATTTTTTTTTTGCAAAAGTGCAAAAATTTTTGGGAGCGAAAATATAAAT
GATAAGAAGAAAAAAAAAGAAAGATATTTTAAAAAAGAAAACATTTTTTGAAATTTCATA
ATAAAAATATTTTAAAATAAAAACAGATAAATACTCAGAACAACACCACTGTTGAGTTCT
TCTTATCTTCAGAGTAATAAAGAATCATAAATGAATTGCTCCCAAAGGGATACTCTCTCT
AGTTCGCTTCCAAGCCAGCCAGATCTAAATCAGGCAGCTTTACCAAAACTATTGCTTAAT
TTGGTCGTTAAAATGTAATCATTTTTTTAAAATACGATTGTCTATTTTAATAATTTTTTT
CGAAATGACTTTGAATTTTTTAAATTCATTTTTATGCATACAAAAAATAAATATATTTAT
ATTTAAATATAGGATGGATAATTAAGAAACTCAAACGGCTAATTCGCTCCTTCCTCTAAA
GCTTCTAAAAAATATGGAACAGGAAAGTTAGCATCATAGGAAGGATATGCTGTCCCTTCG
TTAAGCTACTAAGGAATTAATTAAGCAGCTTATCCTCCTATGCAAGGAAACGGATCAAAT
TAAAATAACAATGGAATGAATACTCCTCAATTAAATAGTTAATCTTCTTAAATTTAGGGC
TAATATAACTAAATCCCTAACTTGAATTAAAGCTAATCTCAAGTCAACTAATAATCTGGT
TTAAATCAGCAATACTCTCAAAACAATAATTAACTTGGATATTAACAGTAATAGCAAATT
TAGCAATAAGCATAAATGAATTAAGGAGTATAGATGAACAATATGCAAATGTAGTAGTAA
TAAATGAACTAAGGAGGAGCCATGTATGGTCAAAACCAAAATAATGACTATTATCAAATG
CAATAATAGAATTCCTCTTAGTATTAAACTTCAGATCAAATTCGTATGAATTAATAAATG
TAATAACCAGATATTTACAACTAACACTTAATCCACATGAAGCCTACTGGTTAACGTAAG
AACACTGTCAGCAAACCTCGCAAAGAAAAAAAACTCAAGCAAAATGAAAAAGCTCAAAAA
TTAAATAAAAGAAAGAGCGATGCAAGTCTTGCTGCTAAAGTCTCAAAGAAGTAAAGAGCT
CTTATGGCTGCTGTTGGAAATGAAGAAATCAGCTATGGAGGTATGCATCCTGTAGAATAA
AAGAAGTGCTTACACATTCTACACTCTCTACAAAAGCACAAATCTTCAAAGCCTTTCTTG
AAACCAGTTGACCCAATAAAAGAAGGATGTCCTGATTATTACATGGTTATCCGCGAACCA
ATGGATTTATCTACTGTTGAAAAAAATCTGAAAGCTCATCTATACTAATCCCCAACATAA
TTTGCTGCTGATATCCACAAGATTTGGAAAAATAGCTTTATTTACAACAATCGTGACTCT
TAAATATATAACATGACTCTTGAAATGGAAAAATATTTCAGCAGAAAGTTCAAAGAAATT
GAAACTAACTTGTATACCAAGACTGATGGAAGAACTTCTACAACTGACATCATTTAGGCA
TTAACAGGCTTCTTAACCTAGAACTAAAAAGGTACAAAGAAAAACAAAATAGCTGGTCTT
TAACCTATCCAAGTCCCCCTAACATCAGCTCCTTAACCCACCAAAAAGACTAAAAATCCT
ACCTCAAAAATGGATATTCCCATGACAATGTAAGAAAAAAAGAATCTCGGACAAAACATT
TTATTACTCCCACCTGAATGTTTACGTGGAGTTTGGGAGATTGTATAATCTGATGGAAAC
TAGCAGTATGACGACAAAATACTCACCTTTGACATTGATGCTCTATCAGTTCGTAAAACT
CGTGAATTAGAATAGTATGTCAAGCAAAACATGGCTGCCAACAACAAAAGACTCTCCAAG
AAGTAAGCAAAAATCCAAGAAAAGTCCATGAATGCTGACTAAAAGCTTATCTAAAATTCA
ACATTCGGTTAAGATGACGAAACTGCAGCTACTCATCATGAAACAGTTATTGTTTAAGGT
AATTTTCCCTTTTTAGAATTTCATTTTCAAAAAAATTATTTATAAAGAATTTTCTTTAAA
AATAAACATTTTAATTTAATTTCACAAACTAAAGATTTTCAATATTTTAATTAAATTTCG
TTTGATATGCTATATTAATATTAGACTATAACTATACAGATATGACTTAGAGCACAATTC
AGCACACACAATAGTATCAAGTTCCTATGCACCCAAGCTAATATCAAATGGAGCAAATGC
ACACCTAAACCATTGGATCTTATGGAAATGGATAGACAGAGTATGCCTAACATCAACATG
ATATGAATTAGGGAATGGATGAATAAGGAGATATCAACGATATAGATTCAGACTCATCTA
ACATTAGTGACAGTAATTTCAATTAATTAAACTATTATTTGGTTTATATAAATTGTATTT
AACTCAAAAATCTAAACTAAAATTTTTATTAAATAGATGACAGTGACAGTCAATTCAATT
GA