Identifiers and Description

Gene Model Identifier

TTHERM_00499530

Standard Name

BrEt-2 (Bromodomain and ET domain 2)

Aliases

PreTt07996 | 63.m00174 | 3716.m00028

Description

Bromodomain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00439 ) Bromodomain
  • ( PF04702 ) Vicilin N terminal region
  • ( PF06133 ) Protein of unknown function (DUF964)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00499530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09681.19.997093137033517e-262bromodomain containing protein
(921 aa)
SGDYDL070W3.001003044337619e-17BDF2 Protein involved in trans
cription initiation at TATA-co
ntaining promoters; associates
with the basal transcription
factor TFIID; contains two bro
modomains; corresponds to the
C-terminal region of mammalian
TAF1; redundant with Bdf1p
WormBaseWBGene000003666.001122775063233e-17locus:cbp-1 Protein cbp-1
status:Partially_confirmed U
niProt:P34545 protein_id:CAD
18875.2
DictyBaseDDB_G02701702.0004286606204839e-16DDB_G0270170 on chromosome: 1
position 4360881 to 4366105
OxytrichaContig20804.0.g300.00000000000001000191320216021Bromodomain
Stentor CoeruleusSteCoe_268400.00000000000009357622968840175

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00499530(coding)
ATGAGTGATTAAGTATAAGAAATATTTTTGACATAAGAGTAATCAAAGTACATCAATAGT
ATGCTACCTAGAGGATACTCACTGTAATTCTCATCTTCTCACACTAGACGTGTTCAAATG
AATCCAAATGCTACAAAGTTAAATCAATATGAGCAAACACTGATCTAAGAGAGGTTAAAG
TAAACTAGATCCAAGATGAATCAGGCAGCAAATGCTTAAAATGCCGCATCATTAGCAGCC
CAACAAAATAAAAATGATAAAGATAAAAAGTTGTAATCCAAAAAAGAAAATATACCTGAA
AAAGAATAAATAGCCGATTCTCCAGAAAGCGGAAATACAAAGAAAAGAAAGTAGTAGGAA
AAAATTTTAGAAAAGTAAGCAGCAAAAAGCTTAAAACAGCAAAATTAAGTTTTATAGTAA
GTAATTAGTGTTGACACACAATAGAAAGGAACAATTCCTGTTTCTGAAGACATAAGGGTG
TGCTTTTCGATATTGTAATAACTAAAGAAAAGCGAAAATGCAGGTCCATTTTTATAAAAA
GTTGATGCCTTAGCACAATAATGCCCTGACTACTATAAAATAATAAGAGATCCAATGGAT
TTATCGAAAGTGGAGTCAAATTTAAAACAGGGCTATTATTAAACTACTTTACAATTCGCA
GATGATGTTAGAAAGATATGGAATAACTCCTTTACATATAACTAAAAAGGAAGCTAAATC
TATAAAATGACAGAAGAAATGAGCAGGTTATTTGAAAAAATTTTTACTCAGGTAAAAAGT
TAATCACTTCCTAACCCTATGGAGTATCAAGATTCAATAGACGCTTCTTCCAACTCTATC
AACAATAATACCGCTTCGTCATTAAAGAAGAGAGCTAATAAATAAGCATAAAATGTTACT
TAATAATAGAATTAGATTTAATAGCTATCTTCTGCTTCAGTGCCAATAACTTAAAATTCA
GCTATACCAGCAAATCCTCCAAAACCTGAAAAATAAAAAAAGACTAAATAAACTGCTAAC
TAACCTGATACAACTGCATAATAAGCCAAAGCTAAAGATAAATATTAAACCAAATTAAGT
TAAGATGAAATCAACTAACTTTATTAAAATATCGGATCGCTTACAGAAGACGATACAAAA
TAATTATACGAGTTAATAAAGGATTACTGTGAAACAAATAACGAATAGATTGAATTAAAT
ATAGATAATCTCCCTATTAAAACTGCAAGAGAAGTACAAGAATTCGTTCTTTTCAAAAGA
CGTTTACCATCTTAGCAATAAGTCAATCAATAACAATAATAATAATAATAGTTGTAGTAA
TAATAATAGTTGTAATAATAATAATAATTACAGCAGCAATAAATCCAATAATAGAAATAG
CAATAGTCATAAGATGAATAGTAAGACAATAAAAAGAAGAAGAAGATTGGAAAATTGGAA
AAGAAAGACATCCCATTAACTATCAGTGAAAAGAAGCAACTAGGAATAAATATACGTAGA
CTTCCTCCAGAAGATTTAAATGGAATTTGGAGTATAGTATAAGATAGCTAATAAAATAGT
GAAGTGATAGAATTTGATATTGATACATTGCCAGTAAGAAAAGCTAGAGAATTAGAAGCA
TATGTCAAGTAAAGAGCTGCATTTCAACAAAAAAAACAACGTGTTTAGAAAAATTAACCA
AATAACCTTTTATCAGACAGCTAACAATAAGCTAAAGCTTAGTTACCATACTCTACGCCT
ACAACAACTACAACTGCAAGTACTACAGTAAATACTAATTAAACTCCAATTGATGCTGCA
GTAAACAACTTCCCACAATAAACTAGCTTTACTGCTGCTTAGTAATATCCTGCCACAGCT
TACGCTAGTAATCCAGGTTATACATAAGCAAATTAACTTATTCAAAATAATGGTTCTGCT
TAAAATGCTGCAAGTGCAAAAGTCAACAACAGCTAAATGATATAGTAGGGATAGTATGTT
CAAGCTAATCCAGTAGCTTAGTAATAACTACCCATTGCTTAAGCAACTACATAATAAAAC
ATGGCTTCTATATAAGGATACAATCATTTAAATTAATAATAGTATGCTTAGCAATCGACA
TACTAAAATTAAATGATGATGAATTAATATCCTTCTGCTTTTCCTATTTAGTAACCTATG
CAAAGCGCTGTCATCGGTGGTTATCAGAACAGACCCAGCTAATAGTATGATGCAGGTTAA
TAAGGCATGGCAATACCAAGCATGATTAATTAAACTTAGCAACCTTATTCAGGATAGCAG
TATAATCAATAGGGATAAGCATAATATTAAGGATATGGAAATAACATGCAAAATATGTAT
ATGAATTAGCCTCTTAGTGCTAATTCAAATGGCAATCACAATAGAAATATTGTGCCTAAT
TAACAAATTCAATATGGAGCTAATACATAAGTGTAAAATGGAATCAGCTAATACCCTCAA
TCGTAAAATTACTACAATGCTTAATATCAATCAAACCCAAGCTAGTATTAGTAACATTTA
CAATAAATGAATGTAAATCCACAGTACAGCAGTAATAGTAATTAAGCTTAGTAATATAAC
GGTCATATTTAAAATTAGAATAACAGTGAGTAAAGTTCTGAAGCAATGCTCTCTGAAAGT
GAGGAAGAGTGA


>TTHERM_00499530(protein)
MSDQVQEIFLTQEQSKYINSMLPRGYSLQFSSSHTRRVQMNPNATKLNQYEQTLIQERLK
QTRSKMNQAANAQNAASLAAQQNKNDKDKKLQSKKENIPEKEQIADSPESGNTKKRKQQE
KILEKQAAKSLKQQNQVLQQVISVDTQQKGTIPVSEDIRVCFSILQQLKKSENAGPFLQK
VDALAQQCPDYYKIIRDPMDLSKVESNLKQGYYQTTLQFADDVRKIWNNSFTYNQKGSQI
YKMTEEMSRLFEKIFTQVKSQSLPNPMEYQDSIDASSNSINNNTASSLKKRANKQAQNVT
QQQNQIQQLSSASVPITQNSAIPANPPKPEKQKKTKQTANQPDTTAQQAKAKDKYQTKLS
QDEINQLYQNIGSLTEDDTKQLYELIKDYCETNNEQIELNIDNLPIKTAREVQEFVLFKR
RLPSQQQVNQQQQQQQQLQQQQQLQQQQQLQQQQIQQQKQQQSQDEQQDNKKKKKIGKLE
KKDIPLTISEKKQLGINIRRLPPEDLNGIWSIVQDSQQNSEVIEFDIDTLPVRKARELEA
YVKQRAAFQQKKQRVQKNQPNNLLSDSQQQAKAQLPYSTPTTTTTASTTVNTNQTPIDAA
VNNFPQQTSFTAAQQYPATAYASNPGYTQANQLIQNNGSAQNAASAKVNNSQMIQQGQYV
QANPVAQQQLPIAQATTQQNMASIQGYNHLNQQQYAQQSTYQNQMMMNQYPSAFPIQQPM
QSAVIGGYQNRPSQQYDAGQQGMAIPSMINQTQQPYSGQQYNQQGQAQYQGYGNNMQNMY
MNQPLSANSNGNHNRNIVPNQQIQYGANTQVQNGISQYPQSQNYYNAQYQSNPSQYQQHL
QQMNVNPQYSSNSNQAQQYNGHIQNQNNSEQSSEAMLSESEEE


>TTHERM_00499530(gene)
ATGAGTGATGTAATATCTTAAATAACTTCCTAAACAGAAGAGCAATCATTTATACTCAAT
TATTTGTGAATTAACTATCATTTTATTCTCTAAATTTTTTGAATTTCAGCAAACCTAATC
TTTGTGTATGATTTTAAAATTAGTAAGTATAAGAAATATTTTTGACATAAGAGTAATCAA
AGTACATCAATAGTATGCTACCTAGAGGATACTCACTGTAATTCTCATCTTCTCACACTA
GACGTGTTCAAATGAATCCAAATGCTACAAAGTTAAATGTAATTTACTTAAAATTTTTTA
GACCAAACTTTTGAGCTTTGTTTACAATTTTTGATGTTACATTAAAGATCATAATTTTAA
ACTTGGAAGAAAACTCTTAAGTATTAAGATAAATAACGATATGAAGGCATTCATATACTC
TTCACCCAAATACAATGCATAGGAAATAAATAAAATGAAATAGAATTTATAATATATTAG
TATAGCAAAATATGTTGCATAGAAAGATATGAAAAATAAAGTTCCTAAATTTTAGATTGA
TTTATTTAAATATCAAACAAAAGCAATATGAGCAAACACTGATCTAAGAGAGGTTAAAGT
AAACTAGATCCAAGATGAATCAGGCAGCAAATGCTTAAAATGCCGCATCATTAGCAGCCC
AACAAAATAAAAATGATAAAGATAAAAAGTTGTAATCCAAAAAAGAAAATATACCTGAAA
AAGAATAAATAGCCGATTCTCCAGAAAGCGGAAATACAAAGAAAAGAAAGTAGTAGGAAA
AAATTTTAGAAAAGTAAGCAGCAAAAAGCTTAAAACAGCAAAATTAAGTTTTATAGTAAG
TAATTAGTGTTGACACACAATAGAAAGGAACAATTCCTGTTTCTGAAGACATAAGGGTGT
GCTTTTCGATATTGTAATAACTAAAGAAAAGCGAAAATGCAGGTCCATTTTTATAAAAAG
TTGATGCCTTAGCACAATAATGCCCTGACTACTATAAAATAATAAGAGATCCAATGGATT
TATCGAAAGTGGAGTCAAATTTAAAACAGGGCTATTATTAAACTACTTTACAATTCGCAG
ATGATGTTAGAAAGATATGGAATAACTCCTTTACATATAACTAAAAAGGAAGCTAAATCT
ATAAAATGACAGAAGAAATGAGCAGGTTATTTGAAAAAATTTTTACTCAGGTAAAAAGTT
AATCACTTCCTAACCCTATGGAGTATCAGTAATAATTTTTTATTTAAATTATAAATGTAA
ATTCATTCAGAATGCTGAAAAATATGAATTTTTGTTAACTTAAACGAAGTAAAACACAAA
AGAAAGGTGGAAAAAATAATTTTATTTTCACATACAAAAAATACAGCAGTAAAAGTTATT
GGTTTTGAGTTGATTCATTTAAAAAATATAATTTTTGAACGAAATCCTCTATTTATTCAA
TAAAATTTCCTCAAAATTGTTGCACTTAATCTTCATTAGTTAATTAAGTGAAAATAAAAA
AATAATTCCATTCAAATTAAAAAAAATTGATTGATTGATTAATTAATTATTTGAACGAAC
ATCTTTTTATAAAATTTTTCAAATTTCTTTAGTGGATAAAAAAATTCCAAATAGGAGCAA
TAACAAAAAATTTCAAATAAAAAGCAATAGGTTGATGGTTGTAGCATTTAAATACATTTT
TAATTAAAATTTACACATTTACTTATATATCTTTTTGATCAAAAAATAAACAACATCAAG
ATCCTTTGCTTTCACTTACTTACATATATTAGGATATATAAATATAATTTTTTAATTTTA
GTTTACCAAAGTCGTAGAACTTAATAAATAAAAAATTAAATATCCTTCATTAATTAATTA
TCAATTTGTATTTTCATTCTCATAATTTTTTGCATACAAAATTAGAGATTCAATAGACGC
TTCTTCCAACTCTATCAACAATAATACCGCTTCGTCATTAAAGAAGAGAGCTAATAAATA
AGCATAAAATGTTACTTAATAATAGAATTAGATTTAATAGCTATCTTCTGCTTCAGTGCC
AATAACTTAAAATTCAGCTATACCAGCAAATCCTCCAAAACCTGAAAAATAAAAAAAGAC
TAAATAAACTGCTAACTAACCTGATACAACTGCATAATAAGCCAAAGCTAAAGATAAATA
TTAAACCAAATTAAGTTAAGATGAAATCAACTAACTTTATTAAAATATCGGATCGCTTAC
AGAAGACGATACAAAATAATTATACGAGTTAATAAAGGATTACTGTGAAACAAATAACGA
ATAGATTGAATTAAATATAGATAATCTCCCTATTAAAACTGCAAGAGAAGTACAAGAATT
CGTTCTTTTCAAAAGACGTTTACCATCTTAGCAATAAGTCAATCAATAACAATAATAATA
ATAATAGTTGTAGTAATAATAATAGTTGTAATAATAATAATAATTACAGCAGCAATAAAT
CCAATAATAGAAATAGCAATAGTCATAAGAGTAATTAATTCTATTTAATTTTTTACTTCA
CCATTAATTTTTGCTAAATAACCTTCAACTCAACCATAAATCTTAAATTTTTTCCAACTG
CTGAACTAAAATAAATTAATTGGTTAATGAAAAAAATATTTTGAATTATAAAAAGAAATT
TATATTGAAAATTATCGCAAAATAATTTATTTAAATTTTACATTAATATTATCATTTTAA
TTAACAAAAGTGAATAGTAAGACAATAAAAAGAAGAAGAAGATTGGAAAATTGGAAAAGA
AAGACATCCCATTAACTATCAGTGAAAAGAAGCAACTAGGAATAAATATACGTAGACTTC
CTCCAGAAGATTTAAATGGAATTTGGAGTATAGTATAAGATAGCTAATAAAATAGTGAAG
TGATAGAATTTGATATTGATACATTGCCAGTAAGAAAAGCTAGAGAATTAGAAGCATATG
TCAAGTAAAGAGCTGCATTTCAACAAAAAAAACAACGTGTTTAGAAAAATTAACCAAATA
ACCTTTTATCAGACAGCTAACAATAAGCTAAAGCTTAGTTACCATACTCTACGCCTACAA
CAACTACAACTGCAAGTACTACAGTAAATACTAATTAAACTCCAATTGATGCTGCAGTAA
ACAACTTCCCACAATAAACTAGCTTTACTGCTGCTTAGTAATATCCTGCCACAGCTTACG
CTAGTAATCCAGGTTATACATAAGCAAATTAACTTATTCAAAATAATGGTTCTGCTTAAA
ATGCTGCAAGTGCAAAAGTCAACAACAGCTAAATGATATAGTAGGGATAGTATGTTCAAG
CTAATCCAGTAGCTTAGTAATAACTACCCATTGCTTAAGCAACTACATAATAAAACATGG
CTTCTATATAAGGATACAATCATTTAAATTAATAATAGTATGCTTAGCAATCGACATACT
AAAATTAAATGATGATGAATTAATATCCTTCTGCTTTTCCTATTTAGTAACCTATGGTAC
TTTCTTGTTCACTTTTTTAAAACTTTTTAAAAATTTTATCAAATATAAAAGCAAAGCGCT
GTCATCGGTGGTTATCAGAACAGACCCAGCTAATAGTATGATGCAGGTTAATAAGGCATG
GCAATACCAAGCATGATTAATTAAACTTAGCAACCTTATTCAGGATAGCAGTATAATCAA
TAGGGATAAGCATAATATTAAGGATATGGAAATAACATGCAAAATATGTATATGAATTAG
CCTCTTAGTGCTAATTCAAATGGCAATCACAATAGAAATATTGTGCCTAATTAACAAATT
CAATATGGAGCTAATACATAAGTGTAAAATGGAATCAGCTAATACCCTCAATCGTAAAAT
TACTACAATGCTTAATATCAATCAAACCCAAGCTAGTATTAGTAACATTTACAATAAATG
AATGTAAATCCACAGTACAGCAGTAATAGTAATTAAGCTTAGTAATATAACGGTCATATT
TAAAATTAGAATAACAGTGAGTAAAGTTCTGAAGCAATGCTCTCTGGTAATTTTAAAAAA
CATTAAAATATTTAATAAAATTATTTAAATTGATTTATTTCTTAAAAATAATTAGAAAGT
GAGGAAGAGTGA