Identifiers and Description

Gene Model Identifier

TTHERM_00623060

Standard Name

BSU2 (Fusion of kelch repeat containing protein and ser/thr phosphatase)

Aliases

PreTt07393 | 87.m00173 | 3814.m00878

Description

Fusion of kelch repeat containing protein and ser/thr phosphatase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00623060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_336440
Tetrahymena borealisEI9_11984.19.997093137033517e-262Ser/Thr protein phosphatase (8
38 aa)
OxytrichaContig10910.0.g979.997093137033517e-262Calcineurin-like phosphoestera
se
WormBaseWBGene000017481.999618694399617e-70locus:gsp-2 Serine/threonine
-protein phosphatase PP1-beta
status:Confirmed UniProt:P
48727 protein_id:CCD61828.1
SGDYER133W4.99966753182923e-69GLC7 Type 1 serine/threonine p
rotein phosphatase catalytic s
ubunit, involved in many proce
sses (eg: glycogen metabolism,
sporulation, mitosis); accumu
lates at mating projections by
interaction with Afr1p; inter
acts with many regulatory subu
nits
DictyBaseDDB_G02756199.99860868304602e-64pppB on chromosome: 2 position
6106886 to 6107851

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00623060(coding)
ATGGAAAAATTAGAAGCATTAGGAACCATGCCTCAAGCTCGTTTTGGGCATACAATTACC
TTCATAACAAAAGGAAAGGCTATTTTATTCGGAGGTGCTACAGGTGACACTGGAAGATTC
TCAATAACTGGAGAAACATATTCTTTTGATGTGCAAACAAGAATTTGGAAAAAGATAGAT
ACAACTGGAGCTTAGCCTTCTCCCAGAGCAGCCCACGCAGCAGTAGCAGTAGAAATAAAT
TAGATTGTAGTCTATGGCGGTGCAACTGGAGGTGGAAGTTTAGCTTCAGATGATTTATAC
TTGCTAGATTTACGTGGCTCTGATGATACTGGTTTATGGACAATAGTTCCAGTAGTTGGT
CAAACGCCTGGAAGACGTTATGGCCACACTATTACATATACTAAACCATACCTAGTAGTA
TTTGGTGGTAACACTGGTTAAGAGCCTGTTAACGATTGTTGGTACTTGAATGTTGAGAAA
AGCCCTTTTAATTGGTCTAAAATTGATGGCAGTAAGCAAGAAAATCCCAGAGTTCGTGTC
TATCATAGTGCATCTCTCTGTTAATAAGGAAGTGCTAATGGTATGGTTGTTATTTTTGGT
GGTCGTTCAAATGATCAATCAGCTTTAAGCGATACATGGGGCTTACGTCGCCACCGTGAT
GGCAGATGGGATTGGGTACGCGCTCCTTCTAAAGGTGATAAAGATTAACCTACAGGTCGT
TATCAACACTCTTCAGCTTTCTTAGGAAAACTTCTTTTGATTATTGGTGGTCGTACTAAT
AATGTTGGAGAGCATTTAGGTATGGAAGTCTATGATACCGAAACTTCTGAATGGTTACGT
TTTAACTCAATCTAACGTTTCCGCCACGGTTCTTGGATTGTTGATAATTCTGTATACGTT
TATGGAGGTTTCGAACTTGAGTCTCCTAATATTCCCACTGACTAAATAACTCGTATCAAC
CTACTTAAAATTTTCTAATCGAACAGTGATCTCACTAACAAGGTGATATAGTACACAAAC
AACAGTAATAATAGCACTCTCCCTTCATAGCCTCATTCTCCTATTTCTCCTAGTTTGAAT
GACTCTAGCACAAATGCTAATTCAAATAATAGCTCTATTAGGTCTGGATTTAGTACTCCG
AACACTTCCCCTTCTATCTAAGGTCCTGTTTCTCCAGTTCTCATGGCATAATAATAAATG
CCTGGTGGATCATACACTATGGGAGGCATATAGAATCCTAATAAACCTAATAACCTTGCT
CCTATGAAGCAAACTACTCTTGGAGGCGGATAGATTTAGAGCAAACCACTAACATTCCTT
CCTGCATTACAGGCTGATGAAACCAACAAAATGTCAGATATGAAGAAAAAAGGAAAAGTC
AATAATATGATCAACTACTCAAATAATGGAATTTACAAGAACCCTACTGATACAAGTGCT
ATCCATCACTAATTCATATAGCATTTATTATAGCCTAAGATGTTCATTAACCTTCCAGAA
AATGTTATTTTTAGATTCACTTCTTAACAAATTATTGAATTATGTGATAAAGCTGAAGAT
ATAATTCGTTAATAACCAATGGTTCTTAGAGTTAGAGCACCTTTGAAAATTTTCGGTGAT
ATCCACGGTTAATATAGTGATTTAATGAGATTCTTTGATTTATGGGGATCTCCTTGTGAA
AATGGTTAGGATGGTGATATAGAAAGTTTTGATTACCTTTTCTTAGGTGATTTCGTAGAT
AGAGGTTCTCATTCCCTTGAAACTATTTGTCTTCTTTTGGCTCTTAAAGTAAAGTACCCC
AACTAAATACATCTTATCCGTGGTAACCATGAAGACAAATGGATCAATAATGGATTTGGA
TTTAGTGATGAGTGTAATCATAGATTGGGTGAAGATCCAAGCGATGATGATTCAGTTTTT
AATAGAGTAAATAGACTTTTTGAATGGCTACCTCTTGCAACAATTATTGAAGACAAAATT
ATTTGCTTGCATGGTGGTATTGGTAGCTCATTACACTATATTCATGAAATTGAAAATCTT
CAACGTCCTCTTGAAGTTATTCATGAAGTTAACACCCCTGATTAATAATTAGTTGTAGAT
ATTTTATGGTCAGATCCTACTGAATCTGATTAAGAGCTTGGTATTCATCCTAATAGTATC
AGAGATCCTGTTGGTTCTGGTAATATCGTGAAATTTGGCCCTGATAGAGTAAACTAGTTC
TTGTAAACAAACAATTTGAGTATGATTATCCGTGCTCATGAATGTGTAATGGATGGATTT
GAACGTTTTGCAGGTGGTAAGTTGATCACTGTATTTAGTGCCACTGACTATTGTGGTAGA
CATAAAAATGCAGGTGCCGTTCTCATTTTAAGAAATAATTTTGAAATTATTCCCAAACTT
ATTTATCCTTCTGAAGCAGCTCAACAACATTACTGGATTGAAGATGATGAAGCTTTAAAG
AAAAGACCACCTACTCCTCCTAGATGGGTTAACAATAATAATAACATCAGAAAATCTTAT
GACTGA


>TTHERM_00623060(protein)
MEKLEALGTMPQARFGHTITFITKGKAILFGGATGDTGRFSITGETYSFDVQTRIWKKID
TTGAQPSPRAAHAAVAVEINQIVVYGGATGGGSLASDDLYLLDLRGSDDTGLWTIVPVVG
QTPGRRYGHTITYTKPYLVVFGGNTGQEPVNDCWYLNVEKSPFNWSKIDGSKQENPRVRV
YHSASLCQQGSANGMVVIFGGRSNDQSALSDTWGLRRHRDGRWDWVRAPSKGDKDQPTGR
YQHSSAFLGKLLLIIGGRTNNVGEHLGMEVYDTETSEWLRFNSIQRFRHGSWIVDNSVYV
YGGFELESPNIPTDQITRINLLKIFQSNSDLTNKVIQYTNNSNNSTLPSQPHSPISPSLN
DSSTNANSNNSSIRSGFSTPNTSPSIQGPVSPVLMAQQQMPGGSYTMGGIQNPNKPNNLA
PMKQTTLGGGQIQSKPLTFLPALQADETNKMSDMKKKGKVNNMINYSNNGIYKNPTDTSA
IHHQFIQHLLQPKMFINLPENVIFRFTSQQIIELCDKAEDIIRQQPMVLRVRAPLKIFGD
IHGQYSDLMRFFDLWGSPCENGQDGDIESFDYLFLGDFVDRGSHSLETICLLLALKVKYP
NQIHLIRGNHEDKWINNGFGFSDECNHRLGEDPSDDDSVFNRVNRLFEWLPLATIIEDKI
ICLHGGIGSSLHYIHEIENLQRPLEVIHEVNTPDQQLVVDILWSDPTESDQELGIHPNSI
RDPVGSGNIVKFGPDRVNQFLQTNNLSMIIRAHECVMDGFERFAGGKLITVFSATDYCGR
HKNAGAVLILRNNFEIIPKLIYPSEAAQQHYWIEDDEALKKRPPTPPRWVNNNNNIRKSY
D


>TTHERM_00623060(gene)
ATGGAAAAATTAGAAGCATTAGGAACCATGCCTCAAGCTCGTTTTGGGCATACAATTACC
TTCATAACAAAAGGAAAGGCTATTTTATTCGGAGGTGCTACAGGTGACACTGGAAGATTC
TCAATAACTGGAGAAACATATTCTTTTGATGTGCAAACAAGAATTTGGAAAAAGATAGAT
AGTAATTATTATGCTCTTCTTTTTTTTTGTTTCCATGCATCTTAATTATGCTTAATATAC
AAACTTGAATATTTTATGAATTAACTCTCACTTCGCATAGGACTTTGAAATTTAAGCTAG
CTATTGAAAAATATCAATCAATATTGCATGCAAAAGTGATGTGAAAGAATTTCATTTCAA
TTTTATATCCCTAAAAATTAAATTGAAAGAAAATACCATTTTAATTATTAGCTTTTGCTT
GTAACAAATCTTAAGAGATGTATCATTAGAATCCTTATCTAAAAATCACTAAATTTTATA
AGTTAATCTTAAAAAGTATTGTGTGATGAAAAGAGTTAAACTTAAAAAAAAATGAGATGC
ATGGAATTTTTAATATATAAAACGATCTATTAACTTTATGTAACTAATAATATAAGCAAC
TGGAGCTTAGCCTTCTCCCAGAGCAGCCCACGCAGCAGTAGCAGTAGAAATAAATTAGAT
TGTAGTCTATGGCGGTGCAACTGGAGGTAATAATAAATTCAAAATTTTTTAGAATGCTAA
GAAGGAAACAATAAAAAACAATATTTTGTATTTTTGCAATAAAAATACCAATTCAAAAAT
AGCAACAAATAAATCAAAAAAAAACTAAATATATGAATTGAATCACAAGCAATTTAGAAA
CATACAAGGATAATATTTTAAAGAAAGAGAGATAAATAGATAAAGAGAGTAGATTTAAAA
AGCCAAATACTTCTAATGTTTAAATCTAATAAACAAACAAATAAAAAACAATATGAAACG
CATATTTTTTCTCAAGAGTTAAATACTTTTCTTTCTCATAAAAAAAATTAGTCTAAAATA
TACTTTCTTGCTTTTTAATTTATTCTATCAATACAAATAATCATCTAAGGTCTTCTCTTT
CTTAGGTTTTGTTGTTTCTTCTTCTTTTCAATTTATTATTATTTGAAGACGCCCTTCACC
GTTCAAATAAGCGAGTGAGAATTGTGGCTGTGTTTTGATTTTACTATTTTCTTAATTTTA
TTAGGCAGTAATGGATATTCTTTAACTTTTGAAACATTTCAAACACGCAATTCAACAACT
CACATAAACATTCAATCAACTAATTAGCCACTTGTTAGTTAGTTAGTTAGCCCTCATCGT
CTTCAACTATTAAAGCAATAAACTAAACCTCAGCTGAACTTAGAAATGATTAAATTATCA
ATGAAAAAAGCTAAAAGATAAAAATGAAAGAATAACATCAAACGAAAGATTGACTGTTAA
ACGAATACTTACTTAGTGAGATGAGGAAACGATCGATCAATTGGTCGACGAATAAGGGAA
TTAATGAATGAATGAGTCAATCAGTCAATAATACAATCAGCTCTCGAATGGAGATGAAGA
TGATGATTTCTAGAAAAAATTTTTTAAATATAAAATTAATAGGATATGTTGACACTTAAG
GAAGGAGACAGTTCTTTCATTCTTTATTTACTTTAAAAACGATTAAAATTCTTATAAAAA
ATTTAATGAGATAGTTTATTAAATTATAAGCAATTATTTCGAGCATAAAAATGAATATTT
AAATTAATTAATAAATCATTTTAAAAATTATCAAAATATTTAGGTTAAGAATAAGTTAAT
TAATTAATTAATTAACTATTATAAAATCAAGGGTAAATTTCTACTTAAATAAAACAAAAA
ATTAATTAGATTATAAAAATACAAATATAAAAGAAAATATTAAATTTAATTTATTTAACA
AACATTCTTTCAATTTCAAAATATATTAATCATTTTTTCATATCATCATCTTCATCGTCA
TCCTGAAGCTAAAATAGTTTTATTATTATTTTTAATTTAATTTAATATAATAGTTTGTTG
AATTGCATCCCAATATGAACTTAAAAATTTTTGAATTTTCAATCAATTATCTAATATATT
TAACAATTTTTCCAAATTAGATAATCAATCATTCACTTATGTTTCATTTCGATTTATCTT
CAACTTTTAATTATAGGTGGAAGTTTAGCTTCAGATGATTTATACTTGCTAGATTTACGT
GGCTCTGATGATACTGGTTTATGGACAATAGTTCCAGTAGTTGGTCAAACGCCTGGAAGA
CGTTATGGCCACACTATTACATATACTAAACCATACCTAGTAGTATTTGGTGGTAACACT
GGTTAAGAGCCTGTTAACGATTGTTGGTACTTGAATGTTGAGAAAAGCCCTTTTAATTGG
TCTAAAATTGATGGCAGTAAGCAAGAAAATCCCAGAGTTCGTGTCTATCATAGTGCATCT
CTCTGTTAATAAGGAAGTGCTAATGGTATGGTTGTTATTTTTGGTGGTCGTTCAAATGAT
CAATCAGCTTTAAGCGATACATGGGGCTTACGTCGCCACCGTGATGGCAGATGGGATTGG
GTACGCGCTCCTTCTAAAGGTGATAAAGATTAACCTACAGGTCGTTATCAACACTCTTCA
GCTTTCTTAGGAAAACTTCTTTTGATTATTGGTGGTCGTACTAATAATGTTGGAGAGCAT
TTAGGTATGGAAGTCTATGATACCGAAACTTCTGAATGGTTACGTTTTAACTCAATCTAA
CGTTTCCGCCACGGTTCTTGGATTGTTGATAATTCTGTATACGTTTATGGAGGTTTCGAA
CTTGAGTCTCCTAATATTCCCACTGACTAAATAACTCGTATCAACCTACTTAAAATTTTC
TAATCGAACAGTGATCTCACTAACAAGGTGATATAGTACACAAACAACAGTAATAATAGC
ACTCTCCCTTCATAGCCTCATTCGTAAATATTAATTTACCAAAATTTATAAATACATATT
TATACATTTTTTTTATAAAAGTCCTATTTCTCCTAGTTTGAATGACTCTAGCACAAATGC
TAATTCAAATAATAGCTCTATTAGGTCTGGATTTAGTACTCCGAACACTTCCCCTTCTAT
CTAAGGTCCTGTTTCTCCAGTTCTCATGGCATAATAATAAATGCCTGGTGGATCATACAC
TATGGGAGGCATATAGAATCCTAATAAACCTAATAACCTTGCTCCTATGAAGCAAACTAC
TCTTGGAGGCGGATAGATTTAGAGCAAACCACTAACATTCCTTCCTGCATTACAGGCTGA
TGAAACCAACAAAATGTCAGATATGAAGAAAAAAGGAAAAGTCAATAATATGATCAACTA
CTCAAATAATGGAATTTACAAGAACCCTACTGATACAAGTGCTATCCATCACTAATTCAT
ATAGCATTTATTATAGCCTAAGATGTTCATTAACCTTCCAGAAAATGTTATTTTTAGATT
CACTTCTTAACAAATTATTGAATTATGTGATAAAGCTGAAGATATAATTCGTTAATAACC
AATGGTTCTTAGAGGTAATTTATTAATATTTAACATGACTAATCAGTTCTCAATTTTTCA
CTAAATTAATAAAAACAGTTAGAGCACCTTTGAAAATTTTCGGTGATATCCACGGTTAAT
ATAGTGATTTAATGAGATTCTTTGATTTATGGGGATCTCCTTGTGAAAATGGTTAGGATG
GTGATATAGAAAGTTTTGATTACCTTTTCTTAGGTGATTTCGTAGATAGAGGTTCTCATT
CCCTTGAAACTATTTGTCTTCTTTTGGCTCTTAAAGTAAAGTACCCCAACTAAATACATC
TTATCCGTGGTAACCATGAAGACAAATGGATCAATAATGGGTAGAATTCTTTTTTAAATA
TTTTAAAATATATTATAACTTTATTTTTATATTTCAATAGATTTGGATTTAGTGATGAGT
GTAATCATAGATTGGGTGAAGATCCAAGCGATGATGATTCAGTTTTTAATAGAGTAAATA
GACTTTTTGAATGGCTACCTCTTGCAACAATTATTGAAGACAAAATTATTTGCTTGCATG
GTGGTATTGGTAGCTCATTACACTATATTCATGAAATTGAAAATCTTCAACGTCCTCTTG
AAGTTATTCATGAAGTTAACACCCCTGATTAATAATTAGTTGTAGATATTTTATGGTCAG
ATCCTACTGAATCTGATTAAGAGCTTGGTATTCATCCTAATAGTATCAGAGATCCTGTTG
GTTCTGGTAATATCGTGAAATTTGGCCCTGATAGAGTAAACTAGTTCTTGTAAACAAACA
ATTTGAGTATGATTATCCGTGCTCATGAATGTGTAATGGATGGATTTGAACGTTTTGCAG
GTGGTAAGTTGATCACTGTATTTAGTGCCACTGACTATTGTGGTAGACATAAAAATGCAG
GTGCCGTTCTCATTTTAAGAAATAATTTTGAAATTATTCCCAAACTTATTTATCCTTCTG
AAGCAGCTCAACAACATTACTGGATTGAAGATGATGAAGCTTTAAAGAAAAGACCACCTA
CTCCTCCTAGATGGGTTAACAATAATAATAACATCAGAAAATCTTATGACTGA