Identifiers and Description

Gene Model Identifier

TTHERM_01107320

Standard Name

BSU1

Aliases

PreTt28081 | 237.m00038 | 3794.m00173

Description

Fusion of kelch repeat containing protein and ser/thr phosphatase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.1%

TetraMine Data

TTHERM_01107320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20288.19.997093137033517e-262Ser/Thr protein phosphatase (8
89 aa)
OxytrichaContig19180.0.g192.000127961544401e-120Galactose oxidase, central dom
ain
SGDYML016C8.998068369452149e-53PPZ1 Serine/threonine protein
phosphatase Z, isoform of Ppz2
p; involved in regulation of p
otassium transport, which affe
cts osmotic stability, cell cy
cle progression, and halotoler
ance
Stentor CoeruleusSteCoe_343825.665668176358939e-52
WormBaseWBGene000017482.9989272749380808e-50locus:gsp-2 Serine/threonine
-protein phosphatase PP1-beta
status:Confirmed UniProt:P
48727 protein_id:CCD61828.1
DictyBaseDDB_G02721164.998233068678632e-48ppp4c on chromosome: 2 positio
n 1426809 to 1428030

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01107320(coding)
ATGACAGAATTATCAACTTAGCTTATGAAAATACAAGGTGGTGGAGATACTCCAGCCCCA
AGATTTGGACATACCTTAACGTTAATTAGTAAATCAAAGGCTGTATTATTCGGAGGTGCT
ATAGGAGACTCTGGAAAGTTTATCATTACTAACGAAACATATATCTTCGATTACGAGTTA
AAGAAATGGAAAAAATTAGAATGTACTGGAGATATCCCTTCATAAAGAGCAGCTCACGCA
AGCTGTTAAATAGATAACATGACTATGGTCATTTATGGTGGAGCTGCATCTGGAGGTGGT
GGATTGTCTAACGATGAACTTTATCTCCTTGACCTTAAGCAATATGATTCAAATGATAAA
TCTACTTAAAACGGACATTATATCAAAGTCCCTACTTCTGGTCCTACTCCTGGTAAGAGA
TATGGCCACACAATGGTCTACTCAAAGCCTCACTTGATAGTCTTTGGTGGTAACACAGGA
ACGATCCCAGTAAATGATGTTTGGGTGCTTAATTTAGAAAAGGGTCCATACTAATGGTAA
AAGTAATGTATTAACGCAGCAGAGGTACCAGCTGTTAGAGTTTATCACTCTGCATCTCTT
TGTTAAACAGGATCAGCAAATGGTATGATGGTCGTGTTTGGTGGTAGAACATAAGACTAG
AGTCCCTTAAACGATACTTGGGGTCTAAGAAGACACCGTAACGGTATGTGGGATTGGGTC
TTAGCTCCTTATAAGTAAAATTCTGCAATATTACCTGTATGTCGCTACCAGCATAGAATT
GAGTTTATTGGACCTTTAATGCTTGTTATTGGAGGTAGAACAAGTGGTGGAGAAGAATAA
GGAAAGTGTGTTGAAGTTTATGATACTGAGAGCAGTGATTGGTATAGAGTTAATAGCTTT
AATAGATATAGACACTCTACAGTTGTGATAGATTCAACAATGTACATTCATGGTGGTTTT
GAGCCAGAATTCCCTAATAAGCCCTTAGATTCAATGATTACTATTGATCTTAATTAGATA
TCTTACTTATTCCCTAAATTAGGAAAACACCTTGGAGTGAAAGATTTTAATAATATTTTA
GGTGAGAGAAATTAAATAGATAAGCCTGCATCATCACCTTCAAATCAATTAAATTAATAG
TAGTTATAAGCTTAGTAATAAAATAGTAATATGTTTAATTAGTAAACATTTTCAAAAAAG
TAAATGTAAAACCAAGCTAATCTTTTGTAACCTTAAAATCAGAACACTAACAACACAAAA
GCATACCAATAAACTTTAAGCAATCAAATGCTTGACATTAGTATAGGAGGTATATAAAAG
GTTCAACTAAAGTAGCTCAACAATGCCTAGAGATCATACACACCTATAAAATAATAAAAG
AATAATAAAGAAATTCGTTTGAGTAATTAAGTTGTAATTGCCAGGACATAAGATTCAGAA
AACATGAACCAATATTACAATATGAATAATTATTAATAATAATAGAACTTTTATGGAGGA
ATTAAAAAAGTTAACATTCTTGATTTATAAGAAGAATCAAAAAAGCTAATTCCATAAAAT
CAAAATGATCACTCTATGATGCTTGTCTCGCCAGTAGATTAAAATACAACAAGTCTTGCT
GAAATGTTTATCAATTCTCTTATGAAAAAACCTGAAGAATGGAAGCACACAGAACTTCGT
TTACCTTTCAAAAAAGAATTTATCCTCAGATTATGTGATGAAGTTTAATAAATAGTGTTA
GATTAACCTTCTCTGCTTCGCTTACGCATTCCTCTTAAAATTTTTGGTAACATTCACGGT
CGCTTCGGTGATTTGTTGAGATTTTTTGGTAACTTTGGTTTTCCCGTTGATGAAGAAGGT
GGAGATATTGAAAAGTTTGACTATCTCTTTTTAGGAAACTATGTAGATCGTGGTTTTAAT
TCATTAGAAACTGTTATCCTTTTGTTTGCCCTAAAACTAAAGTATCCCGATTAAATTCAC
TTAATAAGAGGTGCTCATGAAGAAAGAAGAGTAAATCGTCTATTTGGTTTTGGAGAAGAA
TGCGCTGTACGTTTAAATGAAGATATAAATGACCCTACTTCAGCTTATTAAAGAATAAAC
AGAGTTTTTGATTCTCTTCCATTGGGAGCTCTTATTGAAGAAAAAATTTTCTGTGTCCAT
GGAGGCTTAGGTCCTCATGTCACCCATGTTAATGAAATTGTAGATATAAAAAGACCAGTT
TCACCTTTTTCTAATCCTGTAGTATATGATCTACTTTATTCTGATTATGTAGAAAACGAT
CCTCTCCCTGTTTCAGAAAATAAAGCAAAAGATTATTTCTCAACAGGATAAACTTTCAAA
TACTCAGAAGCTAAAGTTGAGAGATTCCTTGAAGAAACTGGTTTAAATATGATAATCCGT
TCTAAGGAGTGTGTATTTGATGGATTCTCACGCAGTCAATCAGGAAATGTAACAACCATC
ACTAGTTGTAGCGATTACATGGGAAAATATGGTAATTCAGCTTGTTGTATTAGAATAAAG
AAAAACTTTGCCATAGAGCCAAATATTATATCAAGGCCTTAATTCAGAAATGGAAACTGG
GTTGGTGCTGAAAATCCTGTTAAAACTAACTTGTATTTTACAGAGGAAGAACAAAAAATA
CGTAGACGTTTAGCGAGTCCATTGTAAAAGCAATATTGA


>TTHERM_01107320(protein)
MTELSTQLMKIQGGGDTPAPRFGHTLTLISKSKAVLFGGAIGDSGKFIITNETYIFDYEL
KKWKKLECTGDIPSQRAAHASCQIDNMTMVIYGGAASGGGGLSNDELYLLDLKQYDSNDK
STQNGHYIKVPTSGPTPGKRYGHTMVYSKPHLIVFGGNTGTIPVNDVWVLNLEKGPYQWQ
KQCINAAEVPAVRVYHSASLCQTGSANGMMVVFGGRTQDQSPLNDTWGLRRHRNGMWDWV
LAPYKQNSAILPVCRYQHRIEFIGPLMLVIGGRTSGGEEQGKCVEVYDTESSDWYRVNSF
NRYRHSTVVIDSTMYIHGGFEPEFPNKPLDSMITIDLNQISYLFPKLGKHLGVKDFNNIL
GERNQIDKPASSPSNQLNQQQLQAQQQNSNMFNQQTFSKKQMQNQANLLQPQNQNTNNTK
AYQQTLSNQMLDISIGGIQKVQLKQLNNAQRSYTPIKQQKNNKEIRLSNQVVIARTQDSE
NMNQYYNMNNYQQQQNFYGGIKKVNILDLQEESKKLIPQNQNDHSMMLVSPVDQNTTSLA
EMFINSLMKKPEEWKHTELRLPFKKEFILRLCDEVQQIVLDQPSLLRLRIPLKIFGNIHG
RFGDLLRFFGNFGFPVDEEGGDIEKFDYLFLGNYVDRGFNSLETVILLFALKLKYPDQIH
LIRGAHEERRVNRLFGFGEECAVRLNEDINDPTSAYQRINRVFDSLPLGALIEEKIFCVH
GGLGPHVTHVNEIVDIKRPVSPFSNPVVYDLLYSDYVENDPLPVSENKAKDYFSTGQTFK
YSEAKVERFLEETGLNMIIRSKECVFDGFSRSQSGNVTTITSCSDYMGKYGNSACCIRIK
KNFAIEPNIISRPQFRNGNWVGAENPVKTNLYFTEEEQKIRRRLASPLQKQY


>TTHERM_01107320(gene)
ATGACAGAATTATCAACTTAGCTTATGAAAATACAAGGTGGTGGAGATACTCCAGCCCCA
AGATTTGGACATACCTTAACGTTAATTAGTAAATCAAAGGCTGTATTATTCGGAGGTGCT
ATAGGAGACTCTGGAAAGTTTATCATTACTAACGAAACATATATCTTCGATTACGAGTTA
AAGAAATGGAAAAAATTAGAATGTACTGGAGATATCCCTTCATAAAGAGCAGCTCACGCA
AGCTGTTAAATAGATAACATGACTATGGTCATTTATGGTGGAGCTGCATCTGGAGGTGGT
GGATTGTCTAACGATGAACTTTATCTCCTTGACCTTAAGCAATATGATTCAAATGATAAA
TCTACTTAAAACGGACATTATATCAAAGTCCCTACTTCTGGTCCTACTCCTGGTAAGAGA
TATGGCCACACAATGGTCTACTCAAAGCCTCACTTGATAGTCTTTGGTGGTAACACAGGA
ACGATCCCAGTAATATTTATTTCTTATTTTTGAAAAAAAGCTCACTGTTAAGAAAAAAAT
CTGATAGTATGAATATTTTCAAAAAAAATAATTTTAAATTTCAAACAAATGCAGATTAAA
AATTTTTCTTTAAAGTTTAAATCTTCCATTTTTTAATAAAAAATATGCTAACGAAGCCTT
AAAAACAAAACAAAAACAAAAAATATATATTTAGGCGTTTATTAACTGAATTTTTTTAAA
ATATTAGGTAAATGATGTTTGGGTGCTTAATTTAGAAAAGGGTCCATACTAATGGTAAAA
GTAATGTATTAACGCAGCAGAGGTACCAGCTGTTAGAGTTTATCACTCTGCATCTCTTTG
TTAAACAGGATCAGCAAATGGTATGATGGTCGTGTTTGGTGGTAGAACATAAGACTAGAG
TCCCTTAAACGATACTTGGGGTCTAAGAAGACACCGTAACGGTATGTGGGATTGGGTCTT
AGCTCCTTATAAGTAAAATTCTGCAATATTACCTGTATGTCGCTACCAGGTAAATGAAAT
AATTAATTTTATTTATCACATTATATTTTAAAAATCCTAACAGACTTTTTAAATTCAAAA
GTTAACTTTGATCGATATTTGAAAAAAGCTTGAAGCTAAACTTTAAAATCGATATTAATA
AATCAAGAAGCTCTATTGAAAAAATTTATTTCAATCAATTTAGTTTTTGTTTAAAATAGA
TAGATATATTTTTATAGATAAATTTTACATATTTAAAAAAATTATTTTTTTAGATTTTAC
AAAAATCTTGTAAAATTTTATCTTAATTTTATATAATTTTGGAGATCAAATTACTTTGAA
AATCTTTCTGATAAAATTCTACTTTTTATGAAATTTATTAAAAACGTATTAAAGTATTTA
TATTTTTCTAAAATAGCATAGAATTGAGTTTATTGGACCTTTAATGCTTGTTATTGGAGG
TAGAACAAGTGGTGGAGAAGAATAAGGAAAGTGTGTTGAAGTTTATGATACTGAGAGCAG
TGATTGGTATAGAGTTAATAGCTTTAATAGATATAGACACTCTACAGTTGTGATAGATTC
AACAATGTACATTCATGGTGGTTTTGAGCCAGAATTCCCTAATAAGCCCTTAGATTCAAT
GATTACTATTGATCTTAATTAGATATCTTACTTATTCCCTAAATTAGGAAAACACCTTGG
AGTGAAAGATTTTAATAATATTTTAGGTGAGAGAAATTAAATAGATAAGCCTGCATCATC
ACCTTCAAATCAATTAAATTAATAGTAGTTATAAGCTTAGTAATAAAATAGTAATATGTT
TAATTAGTAAACATTTTCAAAAAAGTAAATGTAAAACCAAGCTAATCTTTTGTAACCTTA
AAATCAGAACACTAACAACACAAAAGCATACCAATAAACTTTAAGCAATCAAATGCTTGA
CATTAGTATAGGAGGTATATAAAAGGTTCAACTAAAGTAGCTCAACAATGCCTAGAGATC
ATACACACCTATAAAATAATAAAAGAATAATAAAGAAATTCGTTTGAGTAATTAAGTTGT
AATTGCCAGGACATAAGATTCAGAAAACATGAACCAATATTACAATATGAATAATTATTA
ATAATAATAGAACTTTTATGGAGGAATTAAAAAAGTTAACATTCTTGATTTATAAGAAGA
ATCAAAAAAGCTAATTCCATAAAATCAAAATGATCACTCTATGATGCTTGTCTCGCCAGT
AGATTAAAATACAACAAGTCTTGCTGAAATGTTTATCAATTCTCTTATGAAAAAACCTGA
AGAATGGAAGCACACAGAACTTCGTTTACCTTTCAAAAAAGAATTTATCCTCAGATTATG
TGATGAAGTTTAATAAATAGTGTTAGATTAACCTTCTCTGCTTCGCTTACGCATTCCTCT
TAAAATTTTTGGTAACATTCACGGTCGCTTCGGTGATTTGTTGAGATTTTTTGGTAACTT
TGGTTTTCCCGTTGATGAAGAAGGTGGAGATATTGAAAAGTTTGACTATCTCTTTTTAGG
AAACTATGTAGATCGTGGTTTTAATTCATTAGAAACTGTTATCCTTTTGTTTGCCCTAAA
ACTAAAGTATCCCGATTAAATTCACTTAATAAGAGGTGCTCATGAAGAAAGAAGAGTAAA
TCGTCTATTTGGTTTTGGAGAAGAATGCGCTGTACGTTTAAATGAAGATATAAATGACCC
TACTTCAGCTTATTAAAGAATAAACAGAGTTTTTGATTCTCTTCCATTGGGAGCTCTTAT
TGAAGAAAAAATTTTCTGTGTCCATGGAGGCTTAGGTCCTCATGTCACCCATGTTAATGA
AATTGTAGATATAAAAAGACCAGTTTCACCTTTTTCTAATCCTGTAGTATATGATCTACT
TTATTCTGATTATGTAGAAAACGATCCTCTCCCTGTTTCAGAAAATAAAGCAAAAGATTA
TTTCTCAACAGGATAAACTTTCAAATACTCAGAAGCTAAAGTTGAGAGATTCCTTGAAGA
AACTGGTTTAAATATGATAATCCGTTCTAAGGAGTGTGTATTTGATGGATTCTCACGCAG
TCAATCAGGAAATGTAACAACCATCACTAGTTGTAGCGATTACATGGGAAAATATGGTAA
TTCAGCTTGTTGTATTAGAATAAAGAAAAACTTTGCCATAGAGCCAAATATTATATCAAG
GCCTTAATTCAGAAATGGAAACTGGGTTGGTGCTGAAAATCCTGTTAAAACTAACTTGTA
TTTTACAGAGGAAGAACAAAAAATACGTAGACGTTTAGCGAGTCCATTGTAAAAGCAATA
TTGA