Identifiers and Description

Gene Model Identifier

TTHERM_01245640

Standard Name

BRG1 (Brahma-Related Gene 1)

Aliases

PreTt07348 | 288.m00027

Description

SNF2/brahma-related protein; role in growth and nuclear development

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF07529 ) HSA
  • ( PF08880 ) QLQ
  • ( PF07661 ) MORN repeat variant
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF00176 ) SNF2 family N-terminal domain
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF06465 ) Domain of Unknown Function (DUF1087)
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_01245640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_128930
WormBaseWBGene000168689.997093137033517e-262status:Partially_confirmed U
niProt:Q22944 protein_id:CCD
65417.1
Tetrahymena borealisEI9_01448.19.997093137033517e-262HSA family protein (1233 aa)
DictyBaseDDB_G02710529.997093137033517e-262snf2b on chromosome: 1 positio
n 4502537 to 4512340
OxytrichaContig934.1.g1319.997093137033517e-262SNF2 family N-terminal domain
SGDYOR290C9.997093137033517e-262SNF2 Catalytic subunit of the
SWI/SNF chromatin remodeling c
omplex involved in transcripti
onal regulation; contains DNA-
stimulated ATPase activity; fu
nctions interdependently in tr
anscriptional activation with
Snf5p and Snf6p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16896218: Fillingham JS, Garg J, Tsao N, Vythilingum N, Nishikawa T, Pearlman RE (2006) Molecular genetic analysis of an SNF2/brahma-related gene in Tetrahymena thermophila suggests roles in growth and nuclear development. Eukaryotic cell 5(8):1347-59
  2. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_01245640(coding)
ATGGAAGATAGACTCTCAGAATTAATTCAATAAGCTAAGTACCTTTAGGAAAATGACTAA
ACAGACTCAGATAAGTACTTATAAATTTATGATCAACTCCGTTAAATCACTCTCTAGCAG
AGCGATGAACCAAACTATGCAATGGATCTTGAAGATAAAGCTATAACCAATGATTGTGCA
GAATCGTTGACAGATAAACAAGTTTTCTAAATAAAACAATAAGTTCTTGCTTACAAACAT
ATGATCAGGAACGTTCCACTTCCACGTGAAATAGAAAAGAATATCTACGGATTAACCAAA
GAATAGTGGGACATAGAATCTGAACGCATAATGAGTCGTTCTTTGCGCTATTACAATGAA
AGAATAGATAAAAATGAAGAATTAAAGAGACTTATCATGGATAAATTTAAAAAGCGTAAC
CCAGAGTAAATTCCAAGTGAATCACTTGTTAAAATGGTTAAAGATAACCAATTCCATCTG
AAGAAGAGACAAACTGAGATACAGTCTCTCCTAGGCAACAATATTGAATTGCTCACAGAA
GAAGCTATTGTCCGCCTCAAGGCAGAAAAGCTGATGATTGAACAAATCAATCTCTACAAG
GAAGTTAAAAACAAAATTTTAAAACCAGAAGAAATCACAAGAATGCCTTCGCGCGTATTC
GAAAAGTAGCTTTTAGACAGAAGTTTTTATAAAAAAGAGAAACCATAAAGAAAAAGCGAA
CCTGATTCTTTGAAGAAGTTTGATGTCCAATTCAAGCAAGAATAAGAGAAGAGAAAGAAA
TAAAAGCATAGAGAATTCCTCTAGTAGATTTTCATTCACCAAAATGATTTCTTCGAATTC
CACAAGAAAATCAAGAAATAGTTGAAGAAGCGCTCAAATGCTGCCAGACAATATCTCGAA
TAGCTCCAAATCAAGTAACAAATGCAAAAAGAAAAGGAAGCTAAAGAACGTATTCAAGTT
CTTAAATCAAACAACATCGAAGATTATTATACTTTGATTGCCCAAATGAAAAACTCTCGT
ATTTTAGATCTTTTAAAGTAAACTGATAAATTCTTGCGTGAGCTCGGTGCTAAAATTAAA
GAACAAAAAGGTGATGCTTAAAATGAGGAAGATACTGATATTATGGTAGATCCTTACGAT
GATGATGTCAAATTGTTAGAAAATCTCTCTAAATCAAATAAAGTATATTACAATTTGAGT
CATAAGATTTAAGAAACAATTGACCAATAACCAACTATTCTTGAAGGTGGTAAGCTAAAG
CCTTATCAACTAATAGGTCTTAAATGGCTCATTTCTCTTTACAACAATAAGCTGAATGGT
ATTTTGGCTGATGAAATGGGTTTGGGTAAAACTATTTAAACTATTTCTCTTTTTGCTTAC
CTTATGGAAGTAAAGAAGAACAATGGACCCTTTTTAGTCGTCGTCCCTCTCTCTACAATC
AGTAACTGGGTTCTTGAATTTGATAAATGGGCACCCAAAATCAAGAAAATTGCCTACAAG
GGCTCTCCTCAAGTAAGAAAGGAACTTGCTAAGGAGTTAAAAACAACTAAATGGAATGTT
TGTATTACAACATATGACTACATCTTAAAGGACAGACTCACTCTTCACAAATTCGACTGG
AAATACATTATTGTTGATGAAGGTCACAGAATGAAAAACTCAAAGAGTAAATTCGCTAGT
ATATTAGGCTAACAATACACAAGTGATTATAGAATCCTCCTCACTGGTACTCCACTATAA
AATAACTTGGGAGAATTGTGGGCTTTGTTGAACTTCTTGCTTCCAAAAGTATTTTCAAGT
TGTGACGATTTCGAAAAGTGGTTCTCTATGCCCCTTTCTAAGTTTGGGTCTGCAGCAGAA
AAGGAATCTGCCTTAACAGAAGAAGAAAATTTGCTTATTATCAATCGTTTGCATTAGGTA
CTCAGACCTTTCTTGTTGAGAAGAGTCAAAAAGGAAGTAGAGGCAGAATTACCTGATAAA
GTTGAGCACATTATTAAAGTTGAATTGTCTTCTTGGTAAAAGATTCTTTTCAACAAAATT
AACGATAGAAGTATTGATACCTCAAACGATAATTTCTAATCAAAGAATGGTAAAAAGGCT
TTGATGAATTTGATGATGCAATTGAAGAAATGTTGCAACCATCCTTACCTTTTCTTAAAC
AGTGACGCTTATCAAATTGATGACATGATTTGGAGAGTTTCAGGAAAATTCGAATTACTT
GATAAGATGTTAGCAAAACTAATCCGTACTGGACACAGAGTGCTTATCTTCACATAAATG
ACTCATGTTATGGATCTTATGGAAGAATATTTCAAATTAAGAGAGGACTACATTAAATAT
CTCCGTCTAGATGGTACCACTAAGGCTGATGAAAGAGGTGTTAAGATGGCTCAATTCAAC
TAACCTAACAGTCCATATAATGTTTTCATCCTTTCTACAAGAGCTGGTGGATTAGGTTTG
AACTTGCAAACTGCTGATACAGTTATTATTTTCGATAGTGATTGGAATCCTTAGATGGAT
TAACAAGCTTAAGATAGAGCCCATAGAATCGGCTCCAAGAGTGAGGTCAGAGTTTACAGA
TTAGTCACAAATACTTGGATTGAAGAAGAAATTCTATCTAAAGCTGCCTATAAGATGGGT
CTTGATGAAATGATTATCCAAGCAGGTCTTTATAATTAAAAATCTACTGATAACGATAGA
GAAGAAAAAATTCAAGATTTGCTTAGAAAGAAAAAACGTTATGATGAAATGGATGAAGAA
ATTCCTAACGACGAATAAATTAATTAGATTCTTTGTAGAAACGAAGATGAATACTCAATC
TTCACCTTAATGGATCAAGAAAGAATTGAAAAAGAAAAAGAGAGATACGAAAAGATAATG
TCTTACAATCAAAATCAAGGAGCAAGTGAAGATGAAAATGATAGAAAAGTTAACTATCGT
CTCTGCACTATTGAAGAAGTTCCTGATTGGATAAAGGCTCCTCCTGAGAAAGAATCTGAA
ATAAAAGTCTATGGAAGAGGTTCAAGATAAAGAAAACAAATTAACTATTGTGACACCCTT
ACTGATCTCTAGTTTGCAAAAATGATTGAAGACGGAAAGAATCCTTATAAAAATGGAGAA
AAAATCAACCTTGATGATTATTTGAGCGAAGATGATGAAGATGATTATGATGAAGACGAT
GATGGAGATGATTATAGAGCTAACATCTCTGATAGAAGAGAAAGAAGACTATAAATGTAA
TAGTTATAGGAATAATAATAAAACCAATCATAAGCAGGAGAACCAGCTAAGAAGGACAAT
CCTGATACTTTAGTTCCTGAGAAGTAATTATCTTCTGAAGAACAGAAAAAGCTTGAGGAA
TCAAGGAAGGCTGCAGGCAGAAAAGGAAGACCAAGCAAATAAGAGTTAATGACTCGCAAG
CAAACAAATGATTCATAAAATAATTCTGTGACCAAGTAAGAATATGATGATAAGAGTGCT
CGTAAGAATAAAAAATTGAAAGTGGATGATGATGATTTATAGAGTTAAAATAGTTAGTAG
TAGCAGCAATAAGGAGGCACAAACCAAAGATAGACCAGAACTAGAGGTCAGTAGTAAAAT
GGTAAAAGTAAAGTTGATTACGAAGACAAAATATACATGGAAGAAGAAGATAACTACAAC
GATTTTGAAGAAGAAGATGATGAATGA


>TTHERM_01245640(protein)
MEDRLSELIQQAKYLQENDQTDSDKYLQIYDQLRQITLQQSDEPNYAMDLEDKAITNDCA
ESLTDKQVFQIKQQVLAYKHMIRNVPLPREIEKNIYGLTKEQWDIESERIMSRSLRYYNE
RIDKNEELKRLIMDKFKKRNPEQIPSESLVKMVKDNQFHLKKRQTEIQSLLGNNIELLTE
EAIVRLKAEKLMIEQINLYKEVKNKILKPEEITRMPSRVFEKQLLDRSFYKKEKPQRKSE
PDSLKKFDVQFKQEQEKRKKQKHREFLQQIFIHQNDFFEFHKKIKKQLKKRSNAARQYLE
QLQIKQQMQKEKEAKERIQVLKSNNIEDYYTLIAQMKNSRILDLLKQTDKFLRELGAKIK
EQKGDAQNEEDTDIMVDPYDDDVKLLENLSKSNKVYYNLSHKIQETIDQQPTILEGGKLK
PYQLIGLKWLISLYNNKLNGILADEMGLGKTIQTISLFAYLMEVKKNNGPFLVVVPLSTI
SNWVLEFDKWAPKIKKIAYKGSPQVRKELAKELKTTKWNVCITTYDYILKDRLTLHKFDW
KYIIVDEGHRMKNSKSKFASILGQQYTSDYRILLTGTPLQNNLGELWALLNFLLPKVFSS
CDDFEKWFSMPLSKFGSAAEKESALTEEENLLIINRLHQVLRPFLLRRVKKEVEAELPDK
VEHIIKVELSSWQKILFNKINDRSIDTSNDNFQSKNGKKALMNLMMQLKKCCNHPYLFLN
SDAYQIDDMIWRVSGKFELLDKMLAKLIRTGHRVLIFTQMTHVMDLMEEYFKLREDYIKY
LRLDGTTKADERGVKMAQFNQPNSPYNVFILSTRAGGLGLNLQTADTVIIFDSDWNPQMD
QQAQDRAHRIGSKSEVRVYRLVTNTWIEEEILSKAAYKMGLDEMIIQAGLYNQKSTDNDR
EEKIQDLLRKKKRYDEMDEEIPNDEQINQILCRNEDEYSIFTLMDQERIEKEKERYEKIM
SYNQNQGASEDENDRKVNYRLCTIEEVPDWIKAPPEKESEIKVYGRGSRQRKQINYCDTL
TDLQFAKMIEDGKNPYKNGEKINLDDYLSEDDEDDYDEDDDGDDYRANISDRRERRLQMQ
QLQEQQQNQSQAGEPAKKDNPDTLVPEKQLSSEEQKKLEESRKAAGRKGRPSKQELMTRK
QTNDSQNNSVTKQEYDDKSARKNKKLKVDDDDLQSQNSQQQQQQGGTNQRQTRTRGQQQN
GKSKVDYEDKIYMEEEDNYNDFEEEDDE


>TTHERM_01245640(gene)
ATGGAAGATAGACTCTCAGAATTAATTCAAGTAAATTCTTAATAAATAAATTACTCATTT
ATCAATAATTCTACCAAACTGCCTTCTTTTTATCTATACATTCATACATCACCCATAACC
AATAATTAAATAAATAAATAATTTATCTCTCGATCCATCTTTCGATAAATTCAGATTTAC
TCTTTTCTTTTTTTATTTACTTATTTATTATTTTTTGGTTTTCATTTCCAAAACTTATTT
TATAATTTATTAAAATATATTTATTCAAAATAACTTAATTACACTCTTACTCATTTTATC
ACATTACCCTCTTACCAACAACACTATCAATTAATAAATTATTGATTTCTCTCCTTCTGC
TTTAAATTAATTGTAACCATCTTTTATAAAATTTAGTAAGCTAAGTACCTTTAGGAAAAT
GACTAAACAGACTCAGATAAGTACTTATAAATTTATGATCAACTCCGTTAAATCACTCTC
TAGCAGGTAATTACACATTCTTCAGCCATTAGATTTATTTATCCATATAGCTTTTTAGCA
TATTTCCATGCTTTAAAAGCGATAAAGCAAACCAATAAGCAAGCAAGGATGTAACACAAA
AGGTCAAAAAAAAACTAAATCACTTTTTAGCAAGCTGATTTAAGTAAAGCAAAGCGTATT
TAACATTATCAAATATGGCATAGATAGTAAAAATGCTATAAATTAGATTTAGGCAAGCAC
ATATGCGTTTTAAAAATCATTTTTTTGAAAGACATTTATTTTATTATTCTAGGTTGGTGC
AATTATAATTAAGGATAAATAAATAGCTTAAAAAAAAAAATAGTGAAATAGCAGGATTAA
AGTTTTTTTTATATTGATAGAGCGATGAACCAAACTATGCAATGGATCTTGAAGATAAAG
CTATAACCAATGATTGTGCAGAATCGTTGACAGATAAACAAGTTTTCTAAATAAAACAAT
AAGTTCTTGCTTACAAACATATGATCAGGAACGTTCCACTTCCACGTGAAATAGAAAAGA
ATATCTACGGATTAACCAAAGAATAGTGGGACATAGAATCTGAACGCATAATGAGTCGTT
CTTTGCGCTATTACAATGAAAGAATAGATAAAAATGAAGAATTAAAGAGACTTATCATGG
ATAAATTTAAAAAGCGTAACCCAGAGTAAATTCCAAGTGAATCACTTGTTAAAATGGTTA
AAGATAACCAATTCCATCTGAAGAAGAGACAAACTGAGATACAGTCTCTCCTAGGCAACA
ATATTGAATTGCTCACAGAAGAAGCTATTGTCCGCCTCAAGGCAGAAAAGCTGATGATTG
AACAAATCAATCTCTACAAGGAAGTTAAAAACAAAATTTTAAAACCAGAAGAAATCACAA
GAATGCCTTCGCGCGTATTCGAAAAGTAGCTTTTAGACAGAAGTTTTTATAAAAAAGAGA
AACCATAAAGAAAAAGCGAAGTAAAATATTTTACATATTTTTTATTTCAGTTTGTTTCAG
TTAATTTCAACAAACAATAAAAAAAATAAATAAATCTAATTTAAAACAAATCATTCTTCA
TATTAAACGAGCTATCAATCAAATAAACAAACAAAAACACACACACATCCAAAGAACTAA
ATAATTAAATTAAGAAAGATAATTAAATCAGCAAAAACAACAAGCTATTCTCAAGAAACA
ATAAATATATTTAATTCCTAAAAACCCAAGCAAAATATTTATATATTATTTTTTCATATA
GTGTAAAAATAACTAATAAAAAATCAATCATTCATTAGAATATTTTAATGCAAAAAACTC
TATTAAACAATGGAGATTAATTAATTTATTTAAAGCAAGTAAAAAAACAGCTGTATTAAA
AATTATTGATTTAAAAAAATTGAAATAAGATTAAGAATAAATTATTTATTATCTATCTAT
CTATCTTTTATTTTAAATGATCAAATCAAAAGATAAAATAAATAGTTAGCGGGATCAATT
TAAAATAAAAGTTAGATCAAAAACTTTAATTAATCAATAAAAATTATTGGCTCGCTTTAT
TGCGCGTAGAAAAGATATTTTAAATTTTGTTAATTAAATTTAAAAAGCTTTAACAAATCT
TTTATCTGCCAAATAAATAGTTAGATGCTTTTTTAATCAAATAAAATGAGACAGTTATTT
ATTTAGTTTATTTATTTATTTTTAAGAGCCTGTTCCCGCTTTATAGATTTTGTTGAAATT
ATTTGAAATAAAAATTTAAAACATGACTTAGCCTAATTTAAAAAACTAAAAACACACTTA
TTTATATAATATCAAAAACATAGCCTGATTCTTTGAAGAAGTTTGATGTCCAATTCAAGC
AAGAATAAGAGAAGAGAAAGAAATAAAAGCATAGAGAATTCCTCTAGTAGATTTTCATTC
ACCAAAATGATTTCTTCGAATTCCACAAGAAAATCAAGAAATAGTTGAAGAAGCGCTCAA
ATGCTGCCAGACAATATCTCGAATAGCTCCAAATCAAGTAACAAATGCAAAAAGAAAAGG
AAGCTAAAGAACGTATTCAAGTTCTTAAATCAAACAACATCGAAGATTATTATACTTTGA
TTGCCCAAATGAAAAACTCTCGTATTTTAGATCTTTTAAAGTAAACTGATAAATTCTTGC
GTGAGCTCGGTGCTAAAATTAAAGAACAAAAAGGTAAAAATTAAAAAAATTTAATACTAA
TTAAAACTATCAATTTCTATTTCATCAGAAATTATCAATTTGTTTTTTATAATTTTATCT
TATAATTTCTTCAAAATTTACAAGCTTGTCTTGCATCAACAACAAAAATTAATTTTTGAT
TTAATAATCAAAGAAACTATTTTCATTTCAAAAATATTATTTATGCTTAGTGATTGAATA
TTTGATAGAAAAAAATATATTTTGATCTATTCAAATTTCTTATTAAACCTTTTAATTTAA
AAATTTTGTTGTTGAAGATAATTTAAATGTTTATTATGCTTTGATATTTATTATCATTTA
TTTTTGGAAATCATTTTTAAAATATACTTTAAATTTAAAAATAAATAGGTGATGCTTAAA
ATGAGGAAGATACTGATATTATGGTAGATCCTTACGATGATGATGTCAAATTGTTAGAAA
ATCTCTCTAAATCAAATAAAGTATATTACAATTTGAGTCATAAGATTTAAGAAACAATTG
ACCAATAACCAACTATTCTTGAAGGTGGTAAGCTAAAGCCTTATCAACTAATAGGTCTTA
AATGGCTCATTTCTCTTTACAACAATAAGGTATAAATTATTTAGATTTGTCTCTTAAAAG
GGTTTTTAAAAATTTATATTTTATAAATATTTAGCTGAATGGTATTTTGGCTGATGAAAT
GGGTTTGGGTAAAACTATTTAAACTATTTCTCTTTTTGCTTACCTTATGGAAGTAAAGAA
GAACAATGGACCCTTTTTAGTCGTCGTCCCTCTCTCTACAATCAGTAACTGGGTTCTTGA
ATTTGATAAATGGGCACCCAAAATCAAGAAAATTGCCTACAAGGTAAGAAATAAATATCT
CATGAAAAAATAATGAATTAAAATGTATTTATTAAATAAAAAAGGGCTCTCCTCAAGTAA
GAAAGGAACTTGCTAAGGAGTTAAAAACAACTAAATGGAATGTTTGTATTACAACATATG
ACTACATCTTAAAGGACAGACTCACTCTTCACAAATTCGACTGGAAAGTAAAAGCTTTTC
AACAAATTTATTATCTTCATTAAGTTGATTTGATTTAACAAGATTAAATTTTAAATGCTT
AAAAAATAAAAAGCGTTTCATTGAAATGTTTTACTTAGTTATTAAGCTAAATTTATAGAA
TTTTTTTTGTTGATAATTTTAGTACATTATTGTTGATGAAGGTCACAGAATGAAAAACTC
AAAGAGTAAATTCGCTAGTATATTAGGCTAACAATACACAAGTGATTATAGAATCCTCCT
CACTGGTACTCCACTATAAAATAACTTGGGAGAATTGTGGGCTTTGTTGAACTTCTTGCT
TCCAAAAGTATTTTCAAGTTGTGACGATTTCGAAAAGTGGTTCTCTATGCCCCTTTCTAA
GTTTGGGTCTGCAGCAGAAAAGGAATCTGCCTTAACAGAAGAAGAAAATTTGCTTATTAT
CAATCGTTTGCATTAGGTAATTTTATTTTATTTAGTATTATCAAAGAAGCCAAATATCTT
AATCATTAATTATATTCTAGGTACTCAGACCTTTCTTGTTGAGAAGAGTCAAAAAGGAAG
TAGAGGCAGAATTACCTGATAAAGTTGAGCACATTATTAAAGTTGAATTGTCTTCTTGGT
AAAAGATTCTTTTCAACAAAATTAACGATAGAAGTATTGATACCTCAAACGATAATTTCT
AATCAAAGAATGGTAAAAAGGTAACTAAATAACTAACTAACAAATTTAACTTTTTTAAAG
TATTATTAATAAAATAAACTCTATATTACATATTATACATCATACATCAGAACCCTCCCT
AATTCCATAGTTATATCAAAAATTCAAATTTTAAGAAAAATTTATTTGAAAAAATAGGCT
TTGATGAATTTGATGATGCAATTGAAGAAATGTTGCAACCATCCTTACCTTTTCTTAAAC
AGTGACGCTTATCAAATTGATGACATGATTTGGAGAGTTTCAGGAAAATTCGAATTACTT
GATAAGATGTTAGCAAAACTAATCCGTACTGGACACAGAGTGCTTATCTTCACATAAATG
ACTCATGTTATGGATCTTATGGAAGAATATTTCAAATTAAGAGAGGACTACATTAAATAT
CTCCGTCTAGATGGTACCACTAAGGTATTTATTTAAATAAATTTTTATGAAATTAAAATT
ATTTATAGATTTTTAAATCTATCATTTTTTTTATTTATTAATGATGCTTTTACCAAACAA
AATTTAAACAAATAGCATAATTAAAAAAAAACATATTTCAATTTCTAGTTTTTTTTTTCT
ATTTACAAGTTTTTACTTAGAAAAGAAGGAAAAAATTAAACATTTCATTTTATTAATTTG
GAGAAAAATCATTTAAAGCATTTAACAAAATTAAAATAAAAAATATAGGCTGATGAAAGA
GGTGTTAAGATGGCTCAATTCAACTAACCTAACAGTCCATATAATGTTTTCATCCTTTCT
ACAAGAGCTGGTGGATTAGGTTTGAACTTGCAAACTGCTGATACAGTTATTATTTTCGAT
AGTGATTGGAATCCTTAGATGGATTAACAAGCTTAAGATAGAGCCCATAGAATCGGCTCC
AAGAGTGAGGTCAGAGTTTACAGATTAGTCACAAATACTTGGATTGAAGAAGAAATTCTA
TCTAAAGCTGCCTATAAGATGGGTCTTGATGAAATGATTATCCAAGCAGGTCTTTATAAT
TAAAAATCTACTGATAACGATAGAGAAGAAAAAATTCAAGATTTGCTTAGAAAGAAAAAA
CGTTATGATGAAATGGATGAAGAAATTCCTAACGACGAATAAATTAATTAGATTCTTTGT
AGAAACGAAGTAATTAATTAATTAATTAATTGTTTTTTAATAATATAGTTTTTATTTCAA
CAATAATAATTTTTTTTTTAAAGGATGAATACTCAATCTTCACCTTAATGGATCAAGAAA
GAATTGAAAAAGAAAAAGAGAGATACGAAAAGATAATGTCTTACAATCAAAATCAAGGAG
CAAGTGAAGATGAAAATGATAGAAAAGTTAACTATCGTCTCTGCACTATTGAAGAAGTTC
CTGATTGGATAAAGGCTCCTGTAAATAAAATAATTTTTTACATTTTAATGAATATTTATT
CAAATTTTAATCATTTTTTATACAGCCTGAGAAAGAATCTGAAATAAAAGTCTATGGAAG
AGGTTCAAGATAAAGAAAACAAATTAACTATTGTGACACCCTTACTGATCTCTAGTTTGC
AAAAATGATTGAAGACGGAAAGAATCCTGTAACTAACTTAATTGTTTATTTAAATATAAG
GCTCTTACTAATTTTTTTATTTAAATCGAAAGTATAAAAATGGAGAAAAAATCAACCTTG
ATGATTATTTGAGCGAAGATGATGAAGATGATTATGATGAAGACGATGATGGAGATGATT
ATAGAGCTAACATCTCTGATAGAAGAGAAAGAAGACTATAAATGTAATAGTTATAGGAAT
AATAATAAAACCAATCATAAGCAGGAGAACCAGCTAAGAAGGACAATCCTGATACTTTAG
TTCCTGAGAAGTAATTATCTTCTGAAGAACAGAAAAAGCTTGAGGAATCAAGGAAGGCTG
CAGGCAGAAAAGGAAGACCAAGCAAATAAGAGTTAATGACTCGCAAGCAAACAAATGATT
CATAAAATAATTCTGTGACCAAGTAAGAATATGATGATAAGAGTGCTCGTAAGAATAAAA
AATTGAAAGTGGATGATGATGATTTATAGAGTTAAAATAGTTAGTAGTAGCAGCAATAAG
GAGGCACAAACCAAAGATAGACCAGAACTAGAGGTCAGTAGTAAAATGGTAAAAGTAAAG
TTGATTACGAAGACAAAATATACATGGAAGAAGAAGATAACTACAACGATTTTGAAGAAG
AAGATGATGAATGA