Identifiers and Description

Gene Model Identifier

TTHERM_00442590

Standard Name

BRF1 (Transcription initiation factor TFIIIB, Brf1 subunit)

Aliases

PreTt05659 | 50.m00228 | 3681.m00087

Description

Transcription factor TFIIB repeat family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08271 ) TFIIB zinc-binding
  • ( PF07741 ) Brf1-like TBP-binding domain
  • ( PF00382 ) Transcription factor TFIIB repeat
  • ( TIGR00072 ) hydrogenase maturation protease
  • ( PF06827 ) Zinc finger found in FPG
  • ( PF07754 ) Domain of unknown function (DUF1610)
  • ( PF06844 ) Protein of unknown function (DUF1244)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00442590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12592.19.997093137033517e-262transcription factor TFIIB rep
eat family protein (579 aa)
OxytrichaContig17369.0.g572.0009381340492598e-66Transcription factor TFIIB rep
eat
DictyBaseDDB_G02812151.0003292389192957e-45brf1 on chromosome: 3 position
4228761 to 4230881
SGDYGR246C2.9986404383886433e-43BRF1 TFIIIB B-related factor,
one of three subunits of RNA p
olymerase III transcription in
itiation factor TFIIIB, binds
TFIIIC and TBP and recruits RN
A pol III to promoters, amino-
terminal half is homologous to
TFIIB
WormBaseWBGene000002719.999888128184441e-42locus:brf-1 status:Partially
_confirmed UniProt:Q20429
protein_id:CCD66264.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00442590(coding)
ATGATAGATACAATAGATTACAAATCAAATAAGCAAGTTTGTAAAAAGTGTGGTCATGTT
AATTATGATCTAGACGGTGATGAAGCAGACCAATAAAAATGCAGAAATTGTGGTTTTGTT
ATGTATGAAAACTGCTTCGAATCAGGTATTCAATTTACTGATACCAAGATCGATGGCTAG
TTGCACGATATGTCTAACTTTGGAAGAGATAATACTAAGTATGCTGAAGAATGCATAGCT
ACAATGATAAGAGATTTAAAAATAAAAAGCGAATACCCAGATTATTTAGAAAGAATTGGC
GAAACGCCTTTGAGAATCATGAAATTTGCATATAAAGCTTACTTTTTAGATCACGGTTCA
AATATACATCATTATTCTGCCGCTGCCCTTTATATAGCATTAAGATTTTAAAAGGCTCCC
TTTTTACTTATGGATTTTTCAGAAAAACTTTGCATAAATCTTTTCAAGCTCGCAAGATGC
TATAGAAAATTAGCTAAATTTTTAAATGTAACTCTTAAATTAAATGAAAGACTCCCTTCA
ATAGATCCATCAATTTATATTCCACGTTTTTGCAAGATGCTAGAATTTAATGATAAAGTT
GATTAAGTTAAGGAAACAGCTATCAAACTTTTAAAAAGAATGAAATTGGATTGGATGAGT
CATGGTCGTCGACCAAGTTCTTTGTGTGGTGCTGCCATTTTAATTGCTGCAAGAATGCAT
GGATTTAAGAGAACTACTAGTGAAGTTTGCAAAGTAGTTTATGTTTGTGAAGAAACCTTA
AGAAAAAGATTAGAAGAATTCAAAGAAACAGATGTTGCCAAATTAACAAGAGAAAAATTC
GATGAAATTTAAGATATAGAGTTGATGGGAAGGGAGCGTGATCCTCCTGCTTTCATAAAG
GCTTTAAAAAATTAATAAGAAACTTTAAAAAAAATAAAACCAAATGAAGAAAATGATGAT
GAAATAAATAAACAATTAGAAGATGCAGCAAATATCATAGAGACTCAAGTTAAGTCTACC
AGTAACGAGGGATAATAAGTAAATTAAGATTATGAAATGAGTGATGATATTTCTATTGGA
GATGATGAAGAAGATGAGGGTGAAAATAGTAAATAATAAAATGGAGAAGAGTAGAAAAAG
CAACTTAAGCCTTTATCAGAATCTGAAAGATAAGTCAAAACTTTAGTAAAAAAAGAAGAT
GCTAAATAAATTGGAATTATTAATGAGAATGGTTATTCCTTAAATGTTAGAGAAGATTTA
TCAGATATGAGTGAAGAAGATGTAAATCAATTTATACTCACTAATGAAGAACATACTGTT
AAAAGTATCATATGGCACAGTATGAATGAAACCTGGTTGAGGGAATAATAAAGAAAGGAT
CCAAAAGAAGAAAAAAAAGAATGCAAAAAAAGAAACAAAAGAAGAAATGATTAACTTATG
AATGAAGATGACCCAGTAGATGCCTTATTTAAAAGTAAAAAAATTAGAGAAAAGCTAGAT
GAAAAGAAGGTTCGTGATATGTTCTTATAAATAGAAAAAGTTAAAATGACACAATTGACA
GATATCTTCACAACAGATAAGCCACCTGCTGAATCGCTTGAAACTACATAAAAAATGATA
TACAATAGCGAACTAATTGTTTGCAATGGCCCTATTGATTACATGAATAGATATGGAGCT
AGTAACGATCAGAGCACTCGTGATGCTCCTCAAATAGATCATGATGAAGATGGATTTGAG
TATGATTGA


>TTHERM_00442590(protein)
MIDTIDYKSNKQVCKKCGHVNYDLDGDEADQQKCRNCGFVMYENCFESGIQFTDTKIDGQ
LHDMSNFGRDNTKYAEECIATMIRDLKIKSEYPDYLERIGETPLRIMKFAYKAYFLDHGS
NIHHYSAAALYIALRFQKAPFLLMDFSEKLCINLFKLARCYRKLAKFLNVTLKLNERLPS
IDPSIYIPRFCKMLEFNDKVDQVKETAIKLLKRMKLDWMSHGRRPSSLCGAAILIAARMH
GFKRTTSEVCKVVYVCEETLRKRLEEFKETDVAKLTREKFDEIQDIELMGRERDPPAFIK
ALKNQQETLKKIKPNEENDDEINKQLEDAANIIETQVKSTSNEGQQVNQDYEMSDDISIG
DDEEDEGENSKQQNGEEQKKQLKPLSESERQVKTLVKKEDAKQIGIINENGYSLNVREDL
SDMSEEDVNQFILTNEEHTVKSIIWHSMNETWLREQQRKDPKEEKKECKKRNKRRNDQLM
NEDDPVDALFKSKKIREKLDEKKVRDMFLQIEKVKMTQLTDIFTTDKPPAESLETTQKMI
YNSELIVCNGPIDYMNRYGASNDQSTRDAPQIDHDEDGFEYD


>TTHERM_00442590(gene)
ATGATAGATACAATAGATTACAAATCAAATAAGCAAGTTTGTAAAAAGTGTGGTCATGTT
AATTATGATCTAGACGGTGATGAAGCAGACCAATAAAAATGCAGAAATTGTGGTTTTGTT
ATGTATGAAAACTGCTTCGAATCAGGTATTCAATTTACTGATACCAAGATCGATGGCTAG
TTGCACGATATGTCTAACTTTGGAAGAGATAATACTAAGTATGCTGAAGAATGCATAGCT
ACAATGATAAGAGATTTAAAAATAAAAAGCGAATACCCAGATTATTTAGAAAGAATTGGC
GAAACGCCTTTGAGAATCATGAAATTTGCATATAAAGCTTACTTTTTAGATCACGGTTCA
AATATACATCATTATTCTGCCGCTGCCCTTTATATAGCATTAAGATTTTAAAAGGCTCCC
TTTTTACTTATGGATTTTTCAGAAAAACTTTGCATAAATCTTTTCAAGCTCGCAAGATGC
TATAGAAAATTAGCTAAATTTTTAAATGTAACTCTTAAATTAAATGAAAGACTCCCTTCA
ATAGATCCATCAATTTATATTCCACGGTAATACTCTACACAAACAAACAAATAAATACTC
ACATTAGTGCTATTTATCAAATTTCTATGCTAATTTCTTATTTAATTTTTTAACTTGAGC
GCTTTTTTTCATTTAATGAAAAGCGTCTACAGTGTTATTTATCATAAAGAAATAAATCTA
TAAAAAATATTATTTATATTAAATTCTTATATTAGCAAAGAAAGAATGTGTGTGTATTTA
ACGAATCTTATTTATTTTATTAATAAAAATGTTTTATTTTGTTTATAAATATTACAGTTT
TTGCAAGATGCTAGAATTTAATGATAAAGTTGATTAAGTTAAGGAAACAGCTATCAAACT
TTTAAAAAGAATGAAATTGGATTGGATGAGTCATGGTCGTCGACCAAGTTCTTTGTGTGG
TGCTGCCATTTTAATTGCTGCAAGAATGCATGGATTTAAGAGAACTACTAGTGAAGTTTG
CAAAGTAGTTTATGTTTGTGAAGAAACCTTAAGAAAAAGATTAGAAGAATTCAAAGAAAC
AGATGTTGCCAAATTAACAAGAGAAAAATTCGATGAAATTTAAGATATAGAGTTGATGGG
AAGGGAGCGTGATCCTCCTGCTTTCATAAAGGCTTTAAAAAATTAATAAGAAACTTTAAA
AAAAATAAAACCAAATGAAGAAAATGATGATGAAATAAATAAACAATTAGAAGATGCAGC
AAATATCATAGAGACTCAAGTTAAGTCTACCAGTAACGAGGGATAATAAGTAAATAATAA
TATAAATAATATAAATAATCCAAGTATTTTAAATAAATTTTATCAAATCATATTGATTTA
GGTAAATTAAGATTATGAAATGAGTGATGATATTTCTATTGGAGATGATGAAGAAGATGA
GGGTGAAAATAGTAAATAATAAAATGGAGAAGAGTAGAAAAAGCAACTTAAGCCTTTATC
AGAATCTGAAAGATAAGTCAAAACTTTAGTAAAAAAAGAAGATGCTAAATAAATTGGAAT
TATTAATGAGAATGGTTATTCCTTAAATGTTAGAGAAGATTTATCAGATATGAGTGAAGA
AGATGTAAATCAATTTATACTCACTAATGAAGAACATACTGTTAAAAGTATCATATGGCA
CAGTATGAATGAAACCTGGTTGAGGGAATAATAAAGAAAGGATCCAAAAGAAGAAAAAAA
AGAATGCAAAAAAAGAAACAAAAGAAGAAATGATTAACTTATGAATGAAGATGACCCAGT
AGATGCCTTATTTAAAAGTAAAAAAATTAGAGAAAAGCTAGATGAAAAGAAGGTTCGTGA
TATGTTCTTATAAATAGAAAAAGTTAAAATGACACAATTGACAGATATCTTCACAACAGA
TAAGCCACCTGCTGAATCGCTTGAAACTACATAAAAAATGATATACAATAGCGAACTAAT
TGTTTGCAATGGCCCTATTGATTACATGAATAGATATGGAGCTAGTAACGATCAGAGCAC
TCGTGATGCTCCTCAAATAGATCATGATGAAGATGGATTTGAGTATGATTGA