Identifiers and Description

Gene Model Identifier

TTHERM_00790530

Standard Name

BRE1 (E3 ubiquitin ligase BRE1)

Aliases

PreTt01343 | 133.m00068

Description

E3 ubiquitin ligase; required for H2B ubiquitylation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF05227 ) CHASE3 domain
  • ( PF00435 ) Spectrin repeat
  • ( PF02370 ) M protein repeat
  • ( PF00904 ) Involucrin repeat
  • ( PF06009 ) Laminin Domain II
  • ( PF08252 ) arg-2/CPA1 leader peptide
  • ( TIGR02641 ) gas vesicle protein GvpC repeat
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( PF05911 ) Plant protein of unknown function
  • ( PF09006 ) Lung surfactant protein D coiled-coil

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00790530

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD02309 ) Micronucleus: BRE1 homozygous for neo2 KO
  • ( SD02788 ) Micronucleus: BRE1 homozygous for neo2 KO

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05583.19.997093137033517e-262zinc finger protein (1066 aa)
SGDYDL074C0.0000000000008001317446409227BRE1 E3 ubiquitin ligase, form
s heterodimer with Rad6p to mo
noubiquinate histone H2B-K123,
which is required for the sub
sequent methylation of histone
H3-K4 and H3-K79; required fo
r DSBR, transcription, silenci
ng, and checkpoint control
WormBaseWBGene000070080.00000000019994075865167896locus:rfp-1 E3 ubiquitin-pro
tein ligase bre-1 status:Con
firmed UniProt:P34537 prot
ein_id:CCD73191.1
DictyBaseDDB_G02742410.0000000010002658722841845bre1 on chromosome: 2 position
4227111 to 4230916
OxytrichaContig22668.0.g80.0000009995106777214876Zinc finger, C3HC4 type (RING
finger)
Stentor CoeruleusSteCoe_328910.00001670170079024566

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19822522: Wang Z, Cui B, Gorovsky MA (2009) Histone H2B ubiquitylation is not required for histone H3 methylation at lysine 4 in tetrahymena. The Journal of biological chemistry 284(50):34870-9

Sequences

>TTHERM_00790530(coding)
ATGGAAAAGACTACAAAAGACGCTTTATCTTAGATTCCTAACAGTTAGACTAATAGTAGT
ACCACAGCAATAGGTGGTAATTCCGCTTCAAATGCAAATAATACAAACGCTGTTAGCAAA
TAGAGAGCATAGACTAATGCAGCTGCATTGCAAGATTTATAAAAGATAACAAAACAAAGA
GTGGAGAACTTTTTAAAGAATTTTGAAAATATCTATGCAGATGTTGCAATTGATTGTGCG
ACTTACGGTTAGAGGATGAATGATGCTGTGAAAAGTTTAGCTCAAAACAACGATGCAAAC
GAAACTATGCGTAGACTCTACAGAGAAAATAGCTAGCTGCAAACTAAGATAAAGGAATAG
GAATCTTACCTTTCTAAATCAGTACCCTTGGCAGATACAGAAAAGGATTTTATTATGAAC
TATTTTGGGAATCAAAGCAAGCAATACGAAGAGCTTCTTTAAAAGTACAATGAAGAAAGA
GAAATATCAGAGCGACTTTCACTTAGAATTCGTCAAAAAATGGACTACTGTGTCACATCA
ATTACAGCCAAAGTAGGACAAGATCCGAATCAGATTTTACAAAAAATAATTTAAAATAAT
GCAAATTCTGTTCTAGGTATTAATACGAATAATGCTGCTTCTATGAGTGGCAAAGAGAAT
CAAAATTAACCTAATTTGCTGTCAAGTCAGTCAAGCTAGAATCTCATTGTTTAATAACAG
CAGAATTAAATGGAAATTGAGGATCAGACTTCAAACGCTAATAATAATAATTCTTAGCAG
GAAAATAGATAAGAAGAGAAGGAAGGATATGAATGTATTTGTGGAGGCTATTAAACTGAA
TACTTTAGTTAAAAATATGAAGAAACCTTAAAGTAATTATTGGATACTCAATAAAAGCTA
ATAGCAACTTAAACAATAATCAATACATCTCCTTCATCTGTCATATCAACAGCTTTTACC
TAGCCAGTTGTTGTTCAAAACAGTTAAAATGGGAACAGCATGAGCACAAGCACAGTTAAT
GGGCTATAAACTACTTAGAGTTTGTAATAGCAGCAGCAATAATAATAAGAGCAGTCAACT
GGAAATTAAAATGGGTAATCAAATCAATAAACCAATGCAAGTGTGGATGCTGTAGCTAAC
AGTGATGGGAATAAGAATAATTGCTAAAACTTAGAATTAAATGGATCTGCAAGTGTTGGA
AGCAGCATACCTTGTTTGAAGAAATCGGAATCAATACAAATATAACAATAGCTGCTTTCT
CAACCTGCCTTGCTTACTTAAGTCAGCACTAATATCTAAGATGAGTTGTGTGATGGCAAG
TTGAGATTACCTATAACAGAGAAGCTGTAAATCTTATAGAAGCGTAATGAACAGCTAGTT
TAAGAGAAATCTGAATTAGAAAAGTATATGAGAGAAAGAGAAATCGACTTAAAAAACATG
GAAGATAAGTTCTTTAGATCAGGTGCTTACTAGTCACTTGCAACTCAGACAGAGGAGTTA
CTAAAGATTACAATTTAAATGAGAAGCTAACTGAAAGAAGCAAAATAATAGATAAGTGAC
ATCGAAAAACAACGTTTCAGAGAAATGTAGGAAGTGCTTACAAAATTCAAGGATGAAAAG
GAGACACTTTTGAAATAACTACACGAAGCTAGAGAGGGTGTTTACAAAACTTAGTTAGGA
GATGCTATGAGAGAGAATCTAACTTAGCACTTTAACTATAAAAAGTACACCTAGCCTTTG
GAAGATTAATTAGAGAAGGCAAGTGAAATTCTTACAATTGAAAGAGAACACAATAGAGAT
TTAGAGTAAAAAAAATAACAGCTAAATGAATAAATAATTCAATTATAAAAGCAGAATAGC
GATTTGCAAGCAAAGCTAAATGAAAAAGAACAACAAATAAATTACCTGCAAAGCCAAATG
GGCTTCACTGGCGAGAGCTATGTTGAAGATAAAATTTTTAAATATTAGAACCATAAAGAT
ACTTTAAAGCTTTTGGAAAAAGTAATGAACGATATGTGCAGTGCTGGTTAAATCAATTAA
GAATAAATTAAAAAATTCAGAGACCTTATCGAATATATAAGAAACAGAGAAGAGAAAATT
GTTTAACTGCAAAAGGTAAAGTAACAAAATGATATAGAAAAGAAAAAGTTATAATAAAAT
TAAGATGAAATATGGAAAGAATATGAAAATCTAGATAAGTCTTTTAGCTAGATGAAAGCA
AGATGTGATCAAGTTAACCAAGAATTAAAGTTAATTTAGGAAAGAGAACAAGGACTGGAA
TATAAAAATCTCGAAATCTAAATGCAGTTCTAAAAGGAAAAGCAGTCTTACTCAATCTTG
GTGGCAGCTGATCAGCAAAAAAAGGATAATACTAAAAACTTAATCGATAATCTTGAAGAT
TAAAACAAATAATTATTGTAATAAAACAGTAATCTATCATCAACTATTGAAGAAGTCAAC
TAGCAAAAGCAGCTTATCCAATAACAACTCGAAGAAAATACAGTGCTGTTGCTCGATACA
TAATAAAAGTTTGATCTTCTAAATAAAAAGTTTGGTGATATTAACGAAAAATATAACGAA
CTTATAGCAAACCATGAAAAAATCCAATAAAAATTGCAAACTGCTTACGAAGTCTTAGAC
AACAGCGAGTCTAAAAACACTTCTGCAGAAGTAGCACAACTAAAAGAAAAAATATAAAAT
ATGCGTCTATTGCTCTAATGCAGTTGCGGATAAAACTTCAAAGACACTATCTTATAAAAA
TGCTTGCATCCCTTTTGCAGAGAGTGCATTGATAAATAAATACGTCTTCGTTAGAGAACT
TGCCCAAAGTGCCGTACAGCCTTTGGTCAAAACGACGTTAAAACGTTATATCTAAGTCAT
TGA


>TTHERM_00790530(protein)
MEKTTKDALSQIPNSQTNSSTTAIGGNSASNANNTNAVSKQRAQTNAAALQDLQKITKQR
VENFLKNFENIYADVAIDCATYGQRMNDAVKSLAQNNDANETMRRLYRENSQLQTKIKEQ
ESYLSKSVPLADTEKDFIMNYFGNQSKQYEELLQKYNEEREISERLSLRIRQKMDYCVTS
ITAKVGQDPNQILQKIIQNNANSVLGINTNNAASMSGKENQNQPNLLSSQSSQNLIVQQQ
QNQMEIEDQTSNANNNNSQQENRQEEKEGYECICGGYQTEYFSQKYEETLKQLLDTQQKL
IATQTIINTSPSSVISTAFTQPVVVQNSQNGNSMSTSTVNGLQTTQSLQQQQQQQQEQST
GNQNGQSNQQTNASVDAVANSDGNKNNCQNLELNGSASVGSSIPCLKKSESIQIQQQLLS
QPALLTQVSTNIQDELCDGKLRLPITEKLQILQKRNEQLVQEKSELEKYMREREIDLKNM
EDKFFRSGAYQSLATQTEELLKITIQMRSQLKEAKQQISDIEKQRFREMQEVLTKFKDEK
ETLLKQLHEAREGVYKTQLGDAMRENLTQHFNYKKYTQPLEDQLEKASEILTIEREHNRD
LEQKKQQLNEQIIQLQKQNSDLQAKLNEKEQQINYLQSQMGFTGESYVEDKIFKYQNHKD
TLKLLEKVMNDMCSAGQINQEQIKKFRDLIEYIRNREEKIVQLQKVKQQNDIEKKKLQQN
QDEIWKEYENLDKSFSQMKARCDQVNQELKLIQEREQGLEYKNLEIQMQFQKEKQSYSIL
VAADQQKKDNTKNLIDNLEDQNKQLLQQNSNLSSTIEEVNQQKQLIQQQLEENTVLLLDT
QQKFDLLNKKFGDINEKYNELIANHEKIQQKLQTAYEVLDNSESKNTSAEVAQLKEKIQN
MRLLLQCSCGQNFKDTILQKCLHPFCRECIDKQIRLRQRTCPKCRTAFGQNDVKTLYLSH


>TTHERM_00790530(gene)
ATGGAAAAGACTACAAAAGACGCTTTATCTTAGATTCCTAACAGTTAGACTAATAGTAGT
ACCACAGCAATAGGTGGTAATTCCGCTTCAAATGCAAATAATACAAACGCTGTTAGCAAA
TAGAGAGCATAGACTAATGCAGCTGCATTGCAAGATTTATAAAAGATAACAAAACAAAGA
GTGGAGAACTTTTTAAAGAATTTTGAAAATATCTATGCAGATGTTGCAATTGATTGTGCG
ACTTACGGTTAGAGGATGAATGATGCTGTGAAAAGTTTAGCTCAAAACAACGATGCAAAC
GAAACTATGCGTAGACTCTACAGAGAAAATAGCTAGCTGCAAACTAAGATAAAGGAATAG
GAATCTTACCTTTCTAAATCAGTACCCTTGGCAGATACAGAAAAGGATTTTATTATGAAC
TATTTTGGGAATCAAAGCAAGCAATACGAAGAGCTTCTTTAAAAGTACAATGAAGAAAGA
GAAATATCAGAGCGACTTTCACTTAGAATTCGTCAAAAAATGGACTACTGTGTCACATCA
ATTACAGCCAAAGTAGGACAAGATCCGAATCAGATTTTACAAAAAATAATTTAAAATAAT
GCAAATTCTGTTCTAGGTATTAATACGAATAATGCTGCTTCTATGAGTGGCAAAGAGAAT
CAAAATTAACCTAATTTGCTGTCAAGTCAGTCAAGCTAGAATCTCATTGTTTAATAACAG
CAGAATTAAATGGAAATTGAGGATCAGACTTCAAACGCTAATAATAATAATTCTTAGCAG
GAAAATAGATAAGAAGAGAAGGAAGGATATGAATGTATTTGTGGAGGCTATTAAACTGAA
TACTTTAGTTAAAAATATGAAGAAACCTTAAAGTAATTATTGGATACTCAATAAAAGCTA
ATAGCAACTTAAACAATAATCAATACATCTCCTTCATCTGTCATATCAACAGCTTTTACC
TAGCCAGTTGTTGTTCAAAACAGTTAAAATGGGAACAGCATGAGCACAAGCACAGTTAAT
GGGCTATAAACTACTTAGAGTTTGTAATAGCAGCAGCAATAATAATAAGAGCAGTCAACT
GGAAATTAAAATGGGTAATCAAATCAATAAACCAATGCAAGTGTGGATGCTGTAGCTAAC
AGTGATGGGAATAAGAATAATTGCTAAAACTTAGAATTAAATGGATCTGCAAGTGTTGGA
AGCAGCATACCTTGTTTGAAGAAATCGGAATCAATACAAATATAACAATAGCTGCTTTCT
CAACCTGCCTTGCTTACTTAAGTCAGCACTAATATCTAAGATGAGTTGTGTGATGGCAAG
TTGAGATTACCTATAACAGAGAAGCTGTAAATCTTATAGAAGCGTAATGAACAGCTAGTT
TAAGAGAAATCTGAATTAGAAAAGTATATGAGAGAAAGAGAAATCGACTTAAAAAACATG
GAAGATAAGTTCTTTAGATCAGGTGCTTACTAGTCACTTGCAACTCAGACAGAGGAGTTA
CTAAAGATTACAATTTAAATGAGAAGCTAACTGAAAGAAGCAAAATAATAGATAAGTGAC
ATCGAAAAACAACGTTTCAGAGAAATGTAGGAAGTGCTTACAAAATTCAAGGATGAAAAG
GAGACACTTTTGAAATAACTACACGAAGCTAGAGAGGGTGTTTACAAAACTTAGTTAGGA
GATGCTATGAGAGAGAATCTAACTTAGCACTTTAACTATAAAAAGTACACCTAGCCTTTG
GAAGATTAATTAGAGAAGGCAAGTGAAATTCTTACAATTGAAAGAGAACACAATAGAGAT
TTAGAGTAAAAAAAATAACAGCTAAATGAATAAATAATTCAATTATAAAAGCAGAATAGC
GATTTGCAAGCAAAGCTAAATGAAAAAGAACAACAAATAAATTACCTGCAAAGCCAAATG
GGCTTCACTGGCGAGAGCTATGTTGAAGATAAAATTTTTAAATATTAGAACCATAAAGAT
ACTTTAAAGCTTTTGGAAAAAGTAATGAACGATATGTGCAGTGCTGGTTAAATCAATTAA
GAATAAATTAAAAAATTCAGAGACCTTATCGAATATATAAGAAACAGAGAAGAGAAAATT
GTTTAACTGCAAAAGGTAAAGTAACAAAATGATATAGAAAAGAAAAAGTTATAATAAAAT
TAAGATGAAATATGGAAAGAATATGAAAATCTAGATAAGTCTTTTAGCTAGATGAAAGCA
AGATGTGATCAAGTTAACCAAGAATTAAAGTTAATTTAGGAAAGAGAACAAGGACTGGAA
TATAAAAATCTCGAAATCTAAATGCAGTTCTAAAAGGAAAAGCAGTCTTACTCAATCTTG
GTGGCAGCTGATCAGCAAAAAAAGGATAATACTAAAAACTTAATCGATAATCTTGAAGAT
TAAAACAAATAATTATTGTAATAAAACAGTAATCTATCATCAACTATTGAAGAAGTCAAC
TAGCAAAAGCAGCTTATCCAATAACAACTCGAAGAAAATACAGTGCTGTTGCTCGATACA
TAATAAAAGTTTGATCTTCTAAATAAAAAGTTTGGTGATATTAACGAAAAATATAACGAA
CTTATAGCAAACCATGAAAAAATCCAATAAAAATTGCAAACTGCTTACGAAGTCTTAGAC
AACAGCGAGTCTAAAAACACTTCTGCAGAAGTAGCACAACTAAAAGAAAAAATATAAAAT
ATGCGTCTATTGCTCTAATGCAGTTGCGGATAAAACTTCAAAGACACTATCTTATAAAAA
TGCTTGCATCCCTTTTGCAGAGAGTGCATTGATAAATAAATACGTCTTCGTTAGAGAACT
TGCCCAAAGTGCCGTACAGCCTTTGGTCAAAACGACGTTAAAACGTTATATCTAAGTCAT
TGA