Identifiers and Description

Gene Model Identifier

TTHERM_00490710

Standard Name

BRCT2 (BRCA1 carboxy-Terminus (BRCT) domain protein 2)

Aliases

PreTt08376 | 60.m00173

Description

BRCA1 carboxy-terminus (BRCT) domain protein; BRCA1 C Terminus (BRCT) domain

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00533 ) BRCA1 C Terminus (BRCT) domain
  • ( PF07877 ) Protein of unknown function (DUF1661)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00490710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13541.14.997959784456982e-159BRCT domain-containing protein
(441 aa)
WormBaseWBGene000159910.000050024383570459175status:Partially_confirmed U
niProt:Q18105 protein_id:CCD
62773.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_00490710(coding)
ATGAAAAGTTTCGATTTAGTTTTGGTAACAGGAAACAAGGCCAGCGATAAATAAATCTTT
TAAATGTTGTCTGGAAAGAATGTCATAGGAACAAATATTAAATGTACTACTTAAATAGAA
TAAAAGCTCATAAAACCCATGCATTTCGAGCTATTGATCAATAAATCTGGTAGAATAACT
ATAATACCTTTAACTTCTGGTATGCAGATAATGCAAAAGAATAAAAAATTGAAAGAATTG
GATGTCAATCAATGTTATGATTTGGAAATAAAATAATCCTTTTACATCGAAAGAACTTAT
GCTTGCTATCTTGAGGAAGCTGTCACCAAAAAAAGCCCAATCTAACCTAGCTAACAGGGC
AAATAGTCAATTTGGAATTTAAAGAATAATGCACAGAACAATGAAGATAAAAATAAAAAG
AAGCTGAAAAAAGAAGCTATGGATATCGATAGCTAAGTTTTGAGTGAATCAACTCAATCA
AAATCTGATGAAATTGATGATTTGGCTGATGAGGATTATGATAACTAGGAAGAATAAGAA
GAAATAGTTAAGGATGAAATAAAGCGCAGAAAAGCTCCTTCTAATTCATCTAAAAACTCA
GTTTCTAAGAAAATAAAAAGTCCCAATTCATGTGAAACAACTACTATCATGTAAGCTGAA
AAAAAGATTGAAGTAGAAGAATAAAAAACAAATACAAAATAAAACAATAACAATAAACAG
AAAAAACAAGTGAGAGTCATTCTCTCCAATTGCAATCTGACCAACGCTGAAAAAAATAAA
ATGATTAAGTTGGGAGCTGTTTTTGTAGAGAACTAGGAAGAAGACTTTGATGTAGTTGTT
ATGGAAGAATTCAGAAGAAGAGCTAAACTCTTAATTGGTTTGAACAAAAAGGCTTGGATT
GTCAGCAAGGGATGGATTTTAGATTGCATTGATGATGATGAATTAATTACAGATTTCTGT
GAGTATCTAATTGAAGTACCCTTAGAAGACCAAAAGAAATACAATAACCTTAACCTGGAC
AATGTATAATATAACATACAAAAGGGTAAAGGATTCAAATTATTTGAAAACTGCTCTTTC
TTCCTTCAAGGTTAATATAAAAATATCTTAATTGATGAACTCTAAGCCATTATTATAAGT
GGAGGTGGTAAAATCATAAATAACCTTAACCATAGTTTTTCTTCAGATAAGTAAAAGTAA
ATTGCAGTCATTGAAGACCCAAAGAAAATAAAAAATCCTTTGAATAACACCCTTTATGTT
GATCCTGAATATATTCTTTTATCAACATTAAAGCAATAAATTCAAACAAAATGCATTTAC
AATATTTGA


>TTHERM_00490710(protein)
MKSFDLVLVTGNKASDKQIFQMLSGKNVIGTNIKCTTQIEQKLIKPMHFELLINKSGRIT
IIPLTSGMQIMQKNKKLKELDVNQCYDLEIKQSFYIERTYACYLEEAVTKKSPIQPSQQG
KQSIWNLKNNAQNNEDKNKKKLKKEAMDIDSQVLSESTQSKSDEIDDLADEDYDNQEEQE
EIVKDEIKRRKAPSNSSKNSVSKKIKSPNSCETTTIMQAEKKIEVEEQKTNTKQNNNNKQ
KKQVRVILSNCNLTNAEKNKMIKLGAVFVENQEEDFDVVVMEEFRRRAKLLIGLNKKAWI
VSKGWILDCIDDDELITDFCEYLIEVPLEDQKKYNNLNLDNVQYNIQKGKGFKLFENCSF
FLQGQYKNILIDELQAIIISGGGKIINNLNHSFSSDKQKQIAVIEDPKKIKNPLNNTLYV
DPEYILLSTLKQQIQTKCIYNI


>TTHERM_00490710(gene)
ATGAAAAGTTTCGATTTAGTTTTGGTAACAGGAAACAAGGCCAGCGATAAATAAATCTTT
TAAATGTTGTCTGGAAAGAATGTCATAGGAACAAATATTAAATGTACTACTTAAATAGAA
TAAAAGCTCATAAAACCCATGCATTTCGAGCTATTGATCAATAAATCTGGTAGAATAACT
ATAATACCTTTAACTTCTGGTATGCAGATAATGCAAAAGAATAAAAAATTGAAAGAATTG
GATGTCAATCAATGTTATGATTTGGAAATAAAATAATCCTTTTACATCGAAAGAACTTAT
GCTTGCTATCTTGAGGAAGCTGTCACCAAAAAAAGCCCAATCTAACCTAGCTAACAGGGC
AAATAGTCAATTTGGAATTTAAAGAATAATGCACAGAACAATGAAGATAAAAATAAAAAG
AAGCTGAAAAAAGAAGCTATGGATATCGATAGCTAAGTTTTGAGTGAATCAACTCAATCA
AAATCTGATGAAATTGATGATTTGGCTGATGAGGATTATGATAACTAGGAAGAATAAGAA
GAAATAGTTAAGGATGAAATAAAGCGCAGAAAAGCTCCTTCTAATTCATCTAAAAACTCA
GTTTCTAAGAAAATAAAAAGTCCCAATTCATGTGAAACAACTACTATCATGTAAGCTGAA
AAAAAGATTGAAGTAGAAGAATAAAAAACAAATACAAAATAAAACAATAACAATAAACAG
AAAAAACAAGTGAGAGTCATTCTCTCCAATTGCAATCTGACCAACGCTGAAAAAAATAAA
ATGATTAAGTTGGGAGCTGTTTTTGTAGAGAACTAGGAAGAAGACTTTGATGTAGTTGTT
ATGGAAGAATTCAGAAGAAGAGCTAAACTCTTAATTGGTTTGAACAAAAAGGCTTGGATT
GTCAGCAAGGGATGGATTTTAGATTGCATTGATGATGATGAATTAATTACAGATTTCTGT
GAGTATCTAATTGAAGTACCCTTAGAAGACCAAAAGAAATACAATAACCTTAACCTGGAC
AATGTATAATATAACATACAAAAGGGTAAAGGATTCAAATTATTTGAAAACTGCTCTTTC
TTCCTTCAAGGTTAATATAAAAATATCTTAATTGATGAACTCTAAGCCATTATTATAAGT
GGAGGTGGTAAAATCATAAATAACCTTAACCATAGTTTTTCTTCAGATAAGTAAAAGTAA
ATTGCAGTCATTGAAGACCCAAAGAAAATAAAAAATCCTTTGAATAACACCCTTTATGTT
GATCCTGAATATATTCTTTTATCAACATTAAAGCAATAAATTCAAACAAAATGCATTTAC
AATATTTGA