Identifiers and Description

Gene Model Identifier

TTHERM_00312240

Standard Name

BNI2 (Bud Neck Involved 2)

Aliases

PreTt03412 | 30.m00221 | 3810.m01837

Description

Formin-like protein; homolog of S. cerevisiae Bud Neck gene

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00312240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03239.19.997093137033517e-262hypothetical protein (1269 aa)
DictyBaseDDB_G02855892.9993110246221282e-28forH on chromosome: 4 position
3415704 to 3419613
WormBaseWBGene000189769.997975313387782e-28locus:daam-1 status:Partiall
y_confirmed UniProt:D6VPA1
protein_id:CCD71975.1
Stentor CoeruleusSteCoe_302477.095474162284704e-23
OxytrichaContig999.1.g717.000255027549774e-17Formin Homology 2 Domain
SGDYNL271C0.000005998506718272351BNI1 Formin, nucleates the for
mation of linear actin filamen
ts, involved in cell processes
such as budding and mitotic s
pindle orientation which requi
re the formation of polarized
actin cables, functionally red
undant with BNR1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00312240(coding)
ATGGCACAACTCAATTAGGAAACTTAAAATTAGCTTTAAGAGTTCAACTCTATTATAAAA
TTATTAGAATTAAAAGACAAAGATAAATTAGGCATATAATCTCTACCAAAAGAAAAAAAA
TTAGCTATTTTGCAACTAAGAGAAAAAATCTAAGTTAAAAACGATTTTAACAATTATGGA
AAGAATTCTGAGGAGATAACAGAATATTTTATTCAAAAAATGGAGTTAAATGCTTAGTTT
GAGGATATAATTGCTTTTTATGAATGGATATCTTATCAAATCAAATACAACTAAAAATTA
GATCATTTAGAGCAATCAGGAGGAGTTGATGCTATCATTTTTGCTCTTACATAGTATGGA
TCTTTAAAGCATGATAGTGCAAAAAAGTTATTTCTTCTACATATTCTTAAAATACTTACA
GTCGACTACAAAGATGTTTTCGAAGATAGCACTATTTTCCTTGATAAATTAATTTAGTCA
GATCTTGTACATTCTTTTCCTGAAATGCTTACCCCTGGTCAGAATGAAATAAATAGCTTG
CTGTTAATTTTGATGGATCAGATTTCATGGTATAGTGAAGAAGCTTTAAAGTTTATTTTA
GAAGGATTTGAGGCTTTATAACAGAAAAATAACTATCCAAATAAGTTTACACCTTTAACA
ATAGTTCTAAGTAAATCAAAAAGCTCAATATTTACATAGAATATGTGTTCTTTCTTGAAT
TCAATGTGTTAAGCTTTCTAGAATCATTTTAAAAATATCTAAATAATTGATGACTTTCAA
AATTCAGGCCTATTAGATCTATTGACAGTCTAAGCTGTGAATAATATTTAATAAGGTTAA
TTTATTATCGATGATTGCTATTTTATTAGAGAAGATTATTATGGGGTTTCTGGAGAAGAA
ATATTTTTTGTAGCAGATTTTGAAAGAAGAGAGTTTAACTGTAATAAATTTTTTTACAAG
AAAGATTAAAATGAAGGTGACTTCTAAAGTTAAATAATTACTTTATTTATCTAAATCCAC
TAGCTTCAAGATAAATCAGTAAATCGTATGAGGGAAAGAGAAGCATAATATCAAAAGGAA
TTATAAGCCATTTAGTAAAAAAAAGTGTAATATAATTCTGTCATTAAAGAAGAATAAGAA
GAAGAATATGTAGAGAAAGTTAAAGGCTCTTAAAAATAAGCACAGCTCGAAGAGAGATTC
AAAAGTGAGATTCAAATGAGAGAAAAGGAAAAAATGGAATAAAATCATAGTTAGGATAAT
GATATGAAAAAAGGTTTTGGTAGATAAAATGGAATAGGAAAAGAAAAATCTGAAGAAAAA
AATCAATTATGGTAAACACAATAAAAGATTTAAGCACTTGAAAAAGAGATTGAAAGACTA
AACCAGAAGCTGAAATAGCAGGATTCGTAGGAACAAGTTTCTTAAAATATTTTGAAACAG
CAATTCCTCTAAGGGTAGTTACTGGAGAATTAAAAATTAGAAGAAAAGGAAAAAATTATT
TCAAAATATAAATAGGAAAACATTTAGCTTTTAACAAAAGTGAGTGAATTAGAGCAATCA
AAATAATAGGCACTAGAATAGTTGTCTCTTTCTAAGTAACAAAGCTAGTTGTAGAATCAA
ATAAATCAATAAATGTAAAAAAATGAAGAACTAAGTGAAAAAATTAAATAGCTGAATGAG
AATTTAAGCAGTGTTACTTTCAAATATGAAGAATATAAATCATCAAAAGAGAAAGAAATC
TCTTAATTGAATTTAACTTTGTCTGCTATAAAAGCAAAGCAATCTGTTTCAGAAGAAAAT
AAAAATAACATTTTAGAATAAAATTAAATAATGAATTTGAGATTATCAAAATTAGATTCA
GCCTCTAAATAGCTAGACTCTATTGCAAATAATCACTCAAAAGAATCTGTTATTAAATTA
GTTGAATCCTAATTTTTATAAGAGATATCAGATTTAAAAGAATAAAATTAATTACTTCAA
TCATAAATTAATAAATTAAAATCAAACTAAAACCAATAAAATATTGATAAATTATCAATT
CCTGAAAATCCCTAGATACCTGTAGCTCCTTTACTTGGTTCTTAGTATCCTTCTTAATTA
GCAGTCCCATAAGCTCCAAATTTAGGAATTCCTTAAGCTCCTTAAATACCAGGAATTCCC
TAAGCTCCTTAGATACCTGGAATCCCTCAGGTTTCTTAAATTCCAGGAATTCCTTAGGCT
CCTTAAATAGCAGGAATTCCTTAAGCACCTTAATTATTTGGTATTCCTTAAGCCCCATAA
ATCCCAGGAATACCTCAAGCTCCTTAAATACCTGGCATTCCTTAAGCTCCTTAAATACCT
GGCATTCCTTAAGCTCCTTAAATTCCTGGAATTCCTCTAGCTCCTTAAATACCTGGCATT
CCTTAAGCTCCTTAAATACCTGGAGTTCCTCAAGCTCCACTAATACCAGGAATACCATAA
GCTCCCAATTTTAGTGCTCCTCCTGCACCACAAATTAATGGAATAGGAATTCCGCCTGTT
CCTTAATTAGGTATACCTTCAGTACCTTCTTTACCAGGTTTTGGTGCACCTGCTGCCCCA
AGTTTAAATATCCCTGGGGCTCCAATAGCTATGGCACCTATTTTACCAGGTTTAATGGCC
CCTTAAGTTTAGTAAGGAATAAAACCAAAAAAAAACCCTGGAATTCCAATGAAAGGAGTT
AATTGGCAAACTTTGAAGTTTTAAGACATATAAGGTACAATATGGGAAAAGGTTAAAGAA
GAAAATATAGCTCTTGAAGAAGAATATTTAAAGTAGACTTTCAGTTAGAAAGCTACTTTA
TAAAAGGCATAGAATACAACTTAGTAAAATCCAGAATAGCAAGCATCAAAAAAAATTACA
TTCTTAACATTGGAAAGGCAGTAAAGTGTTTTACTTATACTAGGTAAAATCAAACTAAAA
GGTGAACAAATTGCAGAGATGTTAATCAGCTGTGATCCAACTAGGCTTACTTAAAATCTA
ATTACTTCGTTGCTAGCCTCTTTGCCAAACGAATAAGAGATGATAATGGTTTAATCTTAT
GATGGAAAAATTGAAAATTTAGGTGATGCAGAAAAATATTTTAAAGCTTTGGAAAAAGTA
AATGGGTATGAAGAAAGACTGCAAGCATTAAAATTCAAAAATTTATATCCAGAAACAAAG
GAGTTTTTAACATCTAAAACCACATTGATAGCCCAATTTTTAGACTCTCTTTTAAATGAC
CAAAGAATTACAATTATATTGGAAAATGCTCTTGCTCTTGGTAATTACATGAATGGAACA
GGTTTTAAAGGAGGTGCCTGGGGTTTTAAATTTTCAAATATTGATAAAATGGTAGAAGTA
AAATCAATGGATGGCAAAGTGAATCTTCTTATGTATATGATAAGCAATATAGAGAAAAAA
GAGGGTAAAGAAATAGTTAAAGTTGATGAAGACTTGAAAATTTTAGATGAATGCACTAAA
ACACCAATCAATTAGTTAATTTCAGAAATTGCAGACTTAAAGAGAGGAGTTAAAACCTTG
GAAAAATCTATTAAAGTGCAGACTTCTAACGAACAAGATAAAATCAAGGAATAAATAGAG
CCATTTTACTTGCAAGTATAGCCTGAAATTACTGAATTAGAAAAGCAAGTTAAAGATCTA
GAAGCAAAATATAAAACTGTAGCTGAATTTTTCTGTGAAGATCCCAGAAAGCTACCTTCT
GATGAATTTGCTAAATAAGTACTCATTTTTAAAAAATCATGCATAACAGCAAAGATTTAG
AATAAAAACCTAAAAAGATGA


>TTHERM_00312240(protein)
MAQLNQETQNQLQEFNSIIKLLELKDKDKLGIQSLPKEKKLAILQLREKIQVKNDFNNYG
KNSEEITEYFIQKMELNAQFEDIIAFYEWISYQIKYNQKLDHLEQSGGVDAIIFALTQYG
SLKHDSAKKLFLLHILKILTVDYKDVFEDSTIFLDKLIQSDLVHSFPEMLTPGQNEINSL
LLILMDQISWYSEEALKFILEGFEALQQKNNYPNKFTPLTIVLSKSKSSIFTQNMCSFLN
SMCQAFQNHFKNIQIIDDFQNSGLLDLLTVQAVNNIQQGQFIIDDCYFIREDYYGVSGEE
IFFVADFERREFNCNKFFYKKDQNEGDFQSQIITLFIQIHQLQDKSVNRMREREAQYQKE
LQAIQQKKVQYNSVIKEEQEEEYVEKVKGSQKQAQLEERFKSEIQMREKEKMEQNHSQDN
DMKKGFGRQNGIGKEKSEEKNQLWQTQQKIQALEKEIERLNQKLKQQDSQEQVSQNILKQ
QFLQGQLLENQKLEEKEKIISKYKQENIQLLTKVSELEQSKQQALEQLSLSKQQSQLQNQ
INQQMQKNEELSEKIKQLNENLSSVTFKYEEYKSSKEKEISQLNLTLSAIKAKQSVSEEN
KNNILEQNQIMNLRLSKLDSASKQLDSIANNHSKESVIKLVESQFLQEISDLKEQNQLLQ
SQINKLKSNQNQQNIDKLSIPENPQIPVAPLLGSQYPSQLAVPQAPNLGIPQAPQIPGIP
QAPQIPGIPQVSQIPGIPQAPQIAGIPQAPQLFGIPQAPQIPGIPQAPQIPGIPQAPQIP
GIPQAPQIPGIPLAPQIPGIPQAPQIPGVPQAPLIPGIPQAPNFSAPPAPQINGIGIPPV
PQLGIPSVPSLPGFGAPAAPSLNIPGAPIAMAPILPGLMAPQVQQGIKPKKNPGIPMKGV
NWQTLKFQDIQGTIWEKVKEENIALEEEYLKQTFSQKATLQKAQNTTQQNPEQQASKKIT
FLTLERQQSVLLILGKIKLKGEQIAEMLISCDPTRLTQNLITSLLASLPNEQEMIMVQSY
DGKIENLGDAEKYFKALEKVNGYEERLQALKFKNLYPETKEFLTSKTTLIAQFLDSLLND
QRITIILENALALGNYMNGTGFKGGAWGFKFSNIDKMVEVKSMDGKVNLLMYMISNIEKK
EGKEIVKVDEDLKILDECTKTPINQLISEIADLKRGVKTLEKSIKVQTSNEQDKIKEQIE
PFYLQVQPEITELEKQVKDLEAKYKTVAEFFCEDPRKLPSDEFAKQVLIFKKSCITAKIQ
NKNLKR


>TTHERM_00312240(gene)
ATGGCACAACTCAATTAGGAAACTTAAAATTAGCTTTAAGAGTTCAACTCTATTATAAAA
TTATTAGAATTAAAAGACAAAGATAAATTAGGCATATAATCTCTACCAAAAGGTAAGTAT
TAGCTATATATCTTAAGCCAACTAGAATTAAAAACTATTTTTTGACCAAAAGAAAAAAAA
TTAGCTATTTTGCAACTAAGAGAAAAAATCTAAGTTAAAAACGATTTTAACAATTATGGA
AAGAATTCTGAGGAGATAACAGAATATTTTATTCAAAAAATGGAGTTAAATGCTTAGTTT
GAGGATATAATTGCTTTTTATGAATGGATATCTTATCAAATCAAATACAACTAAAAATTA
GATCATTTAGAGCAATCAGGAGGAGTTGATGCTATCATTTTTGCTCTTACATAGTATGGA
TCTTTAAAGCATGATAGTGCAAAAAAGTTATTTCTTCTACATATTCTTAAAATACTTACA
GTCGACTACAAAGATGTTTTCGAAGATAGCACTATTTTCCTTGATAAATTAATTTAGTCA
GATCTTGTACATTCTTTTCCTGAAATGCTTACCCCTGGTCAGGTATAGATTTTTAACTAA
ATAGTTTACTACTAATTTTAATGAATTTATATAATATATATATATTTTAATTGCATATTT
GTTTATAAATAGAATGAAATAAATAGCTTGCTGTTAATTTTGATGGATCAGATTTCATGG
TATAGTGAAGAAGCTTTAAAGTTTATTTTAGAAGGATTTGAGGCTTTATAACAGAAAAAT
AACTATCCAAATAAGTTTACACCTTTAACAATAGTTCTAAGTAAATCAAAAAGCTCAATA
TTTACATAGAATATGTGTTCTTTCTTGAATTCAATGTGTTAAGCTTTCTAGAATCATTTT
AAAAATATCTAAATAATTGATGACTTTCAAAATTCAGGCCTATTAGATCTATTGACAGTC
GTAAAATAATTTTTAATATAATTAGGATTTAATAAATATGTTAATATAGTAAGCTGTGAA
TAATATTTAATAAGGTTAATTTATTATCGATGATTGCTATTTTATTAGAGAAGATTATTA
TGGGGTTTCTGGAGAAGAAATATTTTTTGTAGCAGATTTTGAAAGAAGAGAGTTTAACTG
TAATAAATTTTTTTACAAGAAAGATTAAAATGAAGGTGACTTCTAAAGTTAAATAATTAC
TTTATTTATCTAAATCCACTAGCTTCAAGATAAGTAAGATAAACTTAAATTATTTTACAT
AATATTTAAATTATGCTTTTATTATAAATAGATCAGTAAGCCTTACATTTTAGTTAGTGG
TTCAAAAAGTTAAATTTATTGGAAATATATATATATTAGGTAAATCGTATGAGGGAAAGA
GAAGCATAATATCAAAAGGAATTATAAGCCATTTAGTAAAAAAAAGTGTAATATAATTCT
GTCATTAAAGAAGAATAAGAAGAAGAATATGTAGAGAAAGTTAAAGGCTCTTAAAAATAA
GCACAGCTCGAAGAGAGATTCAAAGTAAAATTTAAATTAAAAATAATTAATTATATAATA
AACAATAAAATAATTTAACGTTATTTGCAGAGTGAGATTCAAATGAGAGAAAAGGAAAAA
ATGGAATAAAATCATAGTTAGGATAATGATATGAAAAAAGGTTTTGGTAGATAAAATGGA
ATAGGAAAAGAAAAATCTGAAGAAAAAAATCAATTATGGTAAACACAATAAAAGATTTAA
GCACTTGAAAAAGAGATTGAAAGACTAAACCAGAAGCTGAAATAGCAGGATTCGTAGGAA
CAAGTTTCTTAAAATATTTTGAAACAGCAATTCCTCTAAGGGTAGTTACTGGAGAATTAA
AAATTAGAAGAAAAGGAAAAAATTATTTCAAAATATAAATAGGAAAACATTTAGCTTTTA
GTAATTTATTCTTTTGGTTTTCTTAACATTTTAAATTTATTTTATTTGTTAAAAGACAAA
AGTGAGTGAATTAGAGCAATCAAAATAATAGGCACTAGAATAGTTGTCTCTTTCTAAGTA
ACAAAGCTAGTTGTAGAATCAAATAAATCAATAAATGTAAAAAAATGAAGAACTAAGTGA
AAAAATTAAATAGCTGAATGAGAATTTAAGCAGTGTTACTTTCAAATATGAAGAATATAA
ATCATCAAAAGAGAAAGAAATCTCTTAATTGAATTTAACTTTGTCTGCTATAAAAGCAAA
GCAATCTGTTTCAGAAGAAAATAAAAATAACATTTTAGAATAAAATTAAATAATGAATTT
GAGATTATCAAAATTAGATTCAGCCTCTAAATAGCTAGACTCTATTGCAAATAATCACTC
AAAAGAATCTGTTATTAAATTAGTTGAATCCTAATTTTTATAAGAGATATCAGATTTAAA
AGAATAAAATTAATTACTTCAATCATAAATTAATAAATTAAAATCAAACTAAAACCAATA
AAATATTGATAAATTATCAATTCCTGAAAATCCCTAGATACCTGTAGCTCCTTTACTTGG
TTCTTAGTATCCTTCTTAATTAGCAGTCCCATAAGCTCCAAATTTAGGAATTCCTTAAGC
TCCTTAAATACCAGGAATTCCCTAAGCTCCTTAGATACCTGGAATCCCTCAGGTTTCTTA
AATTCCAGGAATTCCTTAGGCTCCTTAAATAGCAGGAATTCCTTAAGCACCTTAATTATT
TGGTATTCCTTAAGCCCCATAAATCCCAGGAATACCTCAAGCTCCTTAAATACCTGGCAT
TCCTTAAGCTCCTTAAATACCTGGCATTCCTTAAGCTCCTTAAATTCCTGGAATTCCTCT
AGCTCCTTAAATACCTGGCATTCCTTAAGCTCCTTAAATACCTGGAGTTCCTCAAGCTCC
ACTAATACCAGGAATACCATAAGCTCCCAATTTTAGTGCTCCTCCTGCACCACAAATTAA
TGGAATAGGAATTCCGCCTGTTCCTTAATTAGGTATACCTTCAGTACCTTCTTTACCAGG
TTTTGGTGCACCTGCTGCCCCAAGTTTAAATATCCCTGGGGCTCCAATAGCTATGGCACC
TATTTTACCAGGTTTAATGGCCCCTTAAGTTTAGTAAGGAATAAAACCAAAAAAAAACCC
TGGAATTCCAATGAAAGGAGTTAATTGGCAAACTTTGAAGTTTTAAGACATATAAGGTAC
AATATGGGAAAAGGTTAAAGAAGAAAATATAGCTCTTGAAGAAGAATATTTAAAGTAGAC
TTTCAGTTAGAAAGCTACTTTATAAAAGGCATAGAATACAACTTAGTAAAATCCAGAATA
GCAAGCATCAGTAAATATTTTTAAATGATGGAAAATTTTTTATTAATTATTTTTTTTGAA
AGAAAAAAATTACATTCTTAACATTGGAAAGGCAGTAAAGTGTTTTACTTATACTAGGTA
AAATCAAACTAAAAGGTGAACAAATTGCAGAGATGTTAATCAGCTGTGATCCAACTAGGC
TTACTTAAAATCTAATTACTTCGTTGCTAGCCTCTTTGCCAAACGAATAAGAGATGATAA
TGGTTTAATCTTATGATGGAAAAATTGAAAATTTAGGTGATGCAGAAAAGTAAAATTTTC
TTCATTATGTCTTGTATTAATTTAAATTTACAGATATTTTAAAGCTTTGGAAAAAGTAAA
TGGGTATGAAGAAAGACTGCAAGCATTAAAATTCAAAAATTTATATCCAGAAACAAAGGA
GTTTTTAACATCTAAAACCACATTGATAGCCCAATTTTTAGACTCTCTTTTAAATGACCA
AAGAATTACAATTATATTGGAAAATGCTCTTGCTCTTGGTAATTACATGAATGGAACAGG
TTTTAAAGGAGGTGCCTGGGGTTTTAAATTTTCAAATATTGATAAAATGGTAGAAGTAAA
ATCAATGGATGGCAAAGTGAATCTTCTTATGTATATGATAAGCAATATAGAGAAAAAAGA
GGTATTTAAATTAGTTTTTATTTATTTATCATGCCAACAAGTATTTTTGTAAAAGGGTAA
AGAAATAGTTAAAGTTGATGAAGACTTGAAAATTTTAGATGAATGCACTAAAACACCAAT
CAATTAGTTAATTTCAGAAATTGCAGACTTAAAGAGAGGAGTTAAAACCTTGGAAAAATC
TATTAAAGTGCAGACTTCTAACGAACAAGATAAAATCAAGGAATAAATAGAGCCATTTTA
CTTGCAAGTATAGCCTGAAATTACTGAATTAGAAAAGCAAGTTAAAGATCTAGAAGCAAA
ATATAAAACTGTAGCTGAATTTTTCTGTGAAGATCCCAGAAAGCTACCTTCTGATGAATT
TGCTAAATAAGTACTCATTTTTAAAAAATCATGCATAACAGCAAAGATTTAGAATAAAAA
CCTAAAAAGATGA