Identifiers and Description

Gene Model Identifier

TTHERM_00239220

Standard Name

BNI1 (Bud Neck Involved 1)

Aliases

PreTt18860 | 20.m00324 | 3706.m00090

Description

Formin-like protein; homolog of S. cerevisiae BNI1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF02181 ) Formin Homology 2 Domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00239220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07876.13.0009656946748407e-152hypothetical protein (712 aa)
DictyBaseDDB_G02913781.000361553249356e-16forJ on chromosome: 6 position
205952 to 213677
OxytrichaContig21525.0.1.g470.0000000000019997478866288316Formin Homology 2 Domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00239220(coding)
ATGTCGACTCCGATAAAGTCTGTAACTCTATCATAAGTAAGCTCTAATTAAAACCTCAAC
CAATCTCCAACAACTTCTCCACCTTAATTGGCATAACCTGAAAAACTAGATCCAAACTAT
TAAACTAATTAGTAATTCCCTCCTACACATTATAGCACTTAAAATAGCTAACAAAGCTAG
TTAATCTAAATGTAACAAGTTCAATATGATGATAATTTAAAATAAAATAAAAATGATTTT
GTGAGCAACAAAGAGTAAAATTTCAACGAAAATAAATAGAATAAATAATAATAGCAATTA
TAAAATAATATTTAAATTAACCACACATAAAATATTCCAAATTCAAATTAATTTATTGTG
AGCAATTAAGAGTTAAATCTAAACGAAAATAAATAGAATAAATAATAATAATAATAAAAT
TAAAGTAATATTTAAAATAGCAACATATAACAAGTTCCAAATACAAATCAGACTTCTTCA
CCTGAGAGATAACAAATCTAATAAGATAAAAAAATTTAATAGGAATTAATAGGTCTAAAG
CAAGAATAGATTAATATGCTAGAATCTCAAAAATCTGCAGTTGCATAAGAGAAAGAAAAG
TTATAATTAAGAAATAGCTAATTAGAGAAAGAGAAAAAATAATAAATTTAAGAAATTAAC
ATTTTAAGTGAGTAACTTCGCTCAAAGACTAACACTCAAACTCAACAAACAATCTTAGAG
GAATCTATTCGTAGAAAAACAAACCAACTATAATAAATAAATTAATAAATTGAAATTCAA
AATGATAAATAAAAATAATTAGAAAATAAATCTCAGTAAGAAAATTAAGAATAAATTGAA
AAATTAAAGCAATATGAACAAAAAATAAAAGAATTAGAAGAAAAATTAAAACAAAAAGAG
TTGGAATCTTAATCAGCTTCAAAATAAAATAGCTAGATAAAATAGACTAACGAATAGTAA
AGTCTAGTATAAAGTATCCCAAAACCACCTATGTTTATACCTCCTCCACCGCCTCCTTTA
AATATTAATATTCCTTCAGCACCTCCATTGATTCCATCTATTCCAGGTGCTCCTATACCT
CCTGCTATAGGACTACCAGTTCCCCCTCCTTTAGGACTCCCTTTTCCACCTCCATTATCA
ATGTAAATAGTGTAACCAAAATCAAAAACTAAACCTCTCTACTGCGATCCTGTAGAATAA
ATTTAAAACACATTGTGGGCTGATGTGAAAGAAATACAAACTATAAAATTTGAAGACTTA
GAAGAAAAATTTTCAAAAGAAAATAATTAAAATTAGCTTAAAAAGTAGATGACAGAAAAA
ACTCCCTCTTAAAAATATTTAGAAATTATTAACAAAAATTAGGCTTAAGGGTAATTTAAT
AATAAAAAAAAATCATTATTTAAGCCAGAAAAAGAAGGAAATTTAAATATCGAGTTTAAA
TAATTTTTAAAGAAAGGTTCAGTAGATGAACTTATACAGGGATTTTAAAAGCTAAATGAA
AATTTAATAACAGAAGAGGATTGTTAAAAAATCCTCAAACTTTTAAATAATTAAGAAGAT
ATTAGGAATTTTGAAGAATTCTAAGGAGATCGTTCAACAATTGATAACCTTTCACAATTT
GTGTTAGGAGTATTAGGAATAGGTAATATTCGCCACAGGTTGATCTATTTTATTTTTAAA
AAAGAATTTTAACAAAGATATTAAGAATCACTAGAGCATTTAAACTAATTGTTAAAAACT
TCTAATGCTGTTTTACAAAGTAACTCGATAAAAGCTTTTCTTTTCTAAGCTTTGGAATTA
AGTAAAGAAATGAACAAAGGAGGCCCGAAAGAAAATATCAAAGGTTTAAAATTATAAACG
ATAATAGATTTAAAATAGCAAAAAAGTACTGACAAAAGCACAGATATTTTACAATACCTT
GTCACTAAAACATACCATTAAAAACCAGAATATCTCAGCTTTGTTGATGAACTTTCGCCT
TTACTAAATCAGACTAAAAATTATGATATTTAAGAGGAAACTAATTAAGCGAAGTAAATG
ATTGATAAATTTACAAAACTTGGTATTAAATTAAAAGAATTAACAAATGATGAAAACATA
GATGCAGATTTCTACAATTTTTTCTAACCATTTTACTAATAAAACCATGAAAAAATAGTT
GAACTCGAGCAGGTACTCTCTCAAACAAAATCTTAGCATTAAAAGTGTTTAGAGCGTTTT
GGTGAAACTAACGATAAATAAAAATCTAATGAATTTTACAAAACAATGCTAGCAATATGT
GAAATGGTTAAAAATGAAATACCTAATAAAATTTATAAATCTTTAAGGCAAAGTTGA


>TTHERM_00239220(protein)
MSTPIKSVTLSQVSSNQNLNQSPTTSPPQLAQPEKLDPNYQTNQQFPPTHYSTQNSQQSQ
LIQMQQVQYDDNLKQNKNDFVSNKEQNFNENKQNKQQQQLQNNIQINHTQNIPNSNQFIV
SNQELNLNENKQNKQQQQQNQSNIQNSNIQQVPNTNQTSSPERQQIQQDKKIQQELIGLK
QEQINMLESQKSAVAQEKEKLQLRNSQLEKEKKQQIQEINILSEQLRSKTNTQTQQTILE
ESIRRKTNQLQQINQQIEIQNDKQKQLENKSQQENQEQIEKLKQYEQKIKELEEKLKQKE
LESQSASKQNSQIKQTNEQQSLVQSIPKPPMFIPPPPPPLNINIPSAPPLIPSIPGAPIP
PAIGLPVPPPLGLPFPPPLSMQIVQPKSKTKPLYCDPVEQIQNTLWADVKEIQTIKFEDL
EEKFSKENNQNQLKKQMTEKTPSQKYLEIINKNQAQGQFNNKKKSLFKPEKEGNLNIEFK
QFLKKGSVDELIQGFQKLNENLITEEDCQKILKLLNNQEDIRNFEEFQGDRSTIDNLSQF
VLGVLGIGNIRHRLIYFIFKKEFQQRYQESLEHLNQLLKTSNAVLQSNSIKAFLFQALEL
SKEMNKGGPKENIKGLKLQTIIDLKQQKSTDKSTDILQYLVTKTYHQKPEYLSFVDELSP
LLNQTKNYDIQEETNQAKQMIDKFTKLGIKLKELTNDENIDADFYNFFQPFYQQNHEKIV
ELEQVLSQTKSQHQKCLERFGETNDKQKSNEFYKTMLAICEMVKNEIPNKIYKSLRQS


>TTHERM_00239220(gene)
ATGTCGACTCCGATAAAGTCTGTAACTCTATCATAAGTAAGCTCTAATTAAAACCTCAAC
CAATCTCCAACAACTTCTCCACCTTAATTGGCATAACCTGAAAAACTAGATCCAAACTAT
TAAACTAATTAGTAATTCCCTCCTACACATTATAGCACTTAAAATAGCTAACAAAGCTAG
TTAATCTAAATGTAACAAGTTCAATATGATGATAATTTAAAATAAAATAAAAATGATTTT
GTGAGCAACAAAGAGTAAAATTTCAACGAAAATAAATAGAATAAATAATAATAGCAATTA
TAAAATAATATTTAAATTAACCACACATAAAATATTCCAAATTCAAATTAATTTATTGTG
AGCAATTAAGAGTTAAATCTAAACGAAAATAAATAGAATAAATAATAATAATAATAAAAT
TAAAGTAATATTTAAAATAGCAACATATAACAAGTTCCAAATACAAATCAGACTTCTTCA
CCTGAGAGATAACAAATCTAATAAGATAAAAAAATTTAATAGGAATTAATAGGTCTAAAG
CAAGAATAGATTAATATGCTAGAATCTCAAAAATCTGCAGTTGCATAAGAGAAAGAAAAG
TTATAATTAAGAAATAGCTAATTAGAGAAAGAGAAAAAATAATAAATTTAAGAAATTAAC
ATTTTAAGTGAGTAACTTCGCTCAAAGACTAACACTCAAACTCAACAAACAATCTTAGAG
GAATCTATTCGTAGAAAAACAAACCAACTATAATAAATAAATTAATAAATTGAAATTCAA
AATGATAAATAAAAATAATTAGAAAATAAATCTCAGTAAGAAAATTAAGAATAAATTGAA
AAATTAAAGCAATATGAACAAAAAATAAAAGAATTAGAAGAAAAATTAAAACAAAAAGAG
TTGGAATCTTAATCAGCTTCAAAATAAAATAGCTAGATAAAATAGACTAACGAATAGTAA
AGTCTAGTATAAAGTATCCCAAAACCACCTATGTTTATACCTCCTCCACCGCCTCCTTTA
AATATTAATATTCCTTCAGCACCTCCATTGATTCCATCTATTCCAGGTGCTCCTATACCT
CCTGCTATAGGACTACCAGTTCCCCCTCCTTTAGGACTCCCTTTTCCACCTCCATTATCA
ATGTAAATAGTGTAACCAAAATCAAAAACTAAACCTCTCTACTGCGATCCTGTAGAATAA
ATTTAAAACACATTGTGGGCTGATGTGAAAGAAATACAAACTATAAAATTTGAAGACTTA
GAAGAAAAATTTTCAAAAGAAAATAATTAAAATTAGCTTAAAAAGTAGATGACAGAAAAA
ACTCCCTCTTAAAAATATTTAGAAATTATTAACAAAAATTAGGCTTAAGGGTAATTTAAT
AATAAAAAAAAATCATTATTTAAGCCAGAAAAAGAAGGAAATTTAAATATCGAGTTTAAA
TAATTTTTAAAGAAAGGTTCAGTAGATGAACTTATACAGGGATTTTAAAAGCTAAATGAA
AATTTAATAACAGAAGAGGATTGTTAAAAAATCCTCAAACTTTTAAATAATTAAGAAGAT
ATTAGGAATTTTGAAGAATTCTAAGGAGATCGTTCAACAATTGATAACCTTTCACAATTT
GTGTTAGGAGTATTAGGAATAGGTAATATTCGCCACAGGTTGATCTATTTTATTTTTAAA
AAAGAATTTTAACAAAGATATTAAGAATCACTAGAGCATTTAAACTAATTGTTAAAAACT
TCTAATGCTGTTTTACAAAGTAACTCGATAAAAGCTTTTCTTTTCTAAGCTTTGGAATTA
AGTAAAGAAATGAACAAAGGAGGCCCGAAAGAAAATATCAAAGGTTTAAAATTATAAACG
ATAATAGATTTAAAATAGCAAAAAAGTACTGACAAAAGCACAGATATTTTACAATACCTT
GTCACTAAAACATACCATTAAAAACCAGAATATCTCAGCTTTGTTGATGAACTTTCGCCT
TTACTAAATCAGACTAAAAATTATGATATTTAAGAGGAAACTAATTAAGCGAAGTAAATG
ATTGATAAATTTACAAAACTTGGTATTAAATTAAAAGAATTAACAAATGATGAAAACATA
GATGCAGATTTCTACAATTTTTTCTAACCATTTTACTAATAAAACCATGAAAAAATAGTT
GAACTCGAGCAGGTACTCTCTCAAACAAAATCTTAGCATTAAAAGTGTTTAGAGCGTTTT
GGTGAAACTAACGATAAATAAAAATCTAATGAATTTTACAAAACAATGCTAGCAATATGT
GAAATGGTTAAAAATGAAATACCTAATAAAATTTATAAATCTTTAAGGCAAAGTTGA