Identifiers and Description

Gene Model Identifier

TTHERM_01262830

Standard Name

BMS1 (ribosome biogenesis protein BMS1 homolog)

Aliases

PreTt01681 | 298.m00022

Description

GTP-binding protein required for 40S ribosome biogenesis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_01262830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21054.19.997093137033517e-262hypothetical protein (1036 aa)
OxytrichaContig17672.0.g1069.997093137033517e-262Protein of unknown function (D
UF663)
SGDYPL217C2.998893725394183e-91BMS1 GTPase required for synth
esis of 40S ribosomal subunits
and for processing the 35S pr
e-rRNA at sites A0, A1, and A2
; interacts with Rcl1p, which
stimulates its GTPase and U3 s
noRNA binding activities; has
similarity to Tsr1p
WormBaseWBGene000220217.999011707514803e-86status:Confirmed UniProt:Q9N
306 protein_id:CCD71775.1
DictyBaseDDB_G02878914.001073573587828e-83bms1l on chromosome: 5 positio
n 751626 to 755503
Stentor CoeruleusSteCoe_190109.221146422925876e-47

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01262830(coding)
ATGGAAATCAGTGATAACGATAGTGTTTTATCTTCTGATAACGAGAACGACGTTAAGTTA
AAGGGATTTGATAAAAACCTTAAAAAAGATGAAGATTCTGATGCAGATGATTAAAAGAAG
GTATTGGCTTCATCTAAGGCTAAGGAAAAAAAGATAAAGGAATCAGAAGAAGGTGAAAAG
AAACCCAAAAAAATTCATTTAAGAAAAGATAAAGGGTATGCAGACTACCTTATAGCTGAA
GAAGATACTTCCGACCTCCCTCCAGTTACTGTTATTGTTTAAGGTCCAAAGCAGAGTGGT
AAAACTACTTTGATAAAGAGTTTAGTAAAAACATACACTAAGCATAGCATTTAGAATGTT
AAAGGTCCTATTACTGTTAGAGCAAATAAAAAGAGAAGAATTACTATTATTGAATGTCCA
AACGATATAAGTGGTATGATCGATATGGCCAAAATTGCAGATATTGCTATTATATTAGTT
GATGCCTCTATTGGTTTCGAAATGGAAACATTCGAATTCCTAAGTTTGCTAAGGGCTCAT
GGTTTCCCTTCCATTATGGGAGTTCTTACTCACACTGATTTCTTCAAAGACAATAAATAA
CTTAGAAAAACCAAAAAGAAATATAAAGCTAGATTTGAACATGAAGTTGGCAATGATTCT
AAACTTTTCTATCTCTCTGGTATGAAATATGGCTAATATTTAAAAAGAGAAGTTCTTAAT
TTATCAAGAATGATTGGTGTTATGAAAGTACAACCTGTTCCTTGGAAGTAGACCCACCCA
TTCATCGTCCCTGATAGATACGAACACTCTCGTGAAGGCTCAAAAGTAGAAGATAATGAG
CTTGTTGATGTTAGCTTTTATGGTTGGATAAAAGGCTCAACCTTCCGTTTGAATAACAAG
ATTCACATTGTAGGTTTAGGAGATTATGAAATTGATAGTACTGATATCATCGAAGATCCT
GTTCCTGTTGTAGAAGTTAAAGTACATGAAGATAAAAAGAAAAAAGAGGAAGGAAGTGGT
AAATAGGATGGTTAAAGCGATGGTAGTGAAGGTGATGATGAATCAAGCGAAGAAAGCGAA
GATGAAGAAGAAAATAAATAAGAGGGTAAAAAGGAAGAACCCAAAATTAAAAAAATTAAG
CAAAAAAGAACATTGAAACAATCAGAAAAGATTGTTTATGCCCCTTTCAGTAACTTAGGT
TTTTTGAATTATGAAAAAAGTGGTGGATATATTACTATTCCTGATGAGCACGTTGTCTTT
ACCAAAAAAAATTAACAAGATGTTTATGATGATAATGGAGAGTTGATAGAATAATAGGAA
GATGAAGATTTAGGTGAAGGTGTTAAGATGGTTAGAGATTTATAGGATATGAAAAAAACT
TTAAATGAAAAGCTAGATGAAGATGACGATGTTGAACTTCTCGATGGTATCGAATTAGGA
GAACAAAAGAAAAATATTCTTGAATTCACAGCTGAAGAAAAGAAGAAATTAGATTTTAAG
GAAAAGCAAAAAGAAATAGTTAATCTTAAGCACAAGACTAAGGATTTAAATTAAATTGCA
AATGCTATAGAATAATAATAATCAGTTATGGCTACTGATTTACAAGATCTCATTTATGGT
AAAACTGACAAAAAAATATGCAATTTCGATAGCAGTAACTTTAGAAGTAAAGAATTATAC
ACTAGAGATTTATATAAGGCCTTAGTAAAATGCAAATTTATGGCTGGCTCATTGATAGAA
GAGGAAGCCCCAGAAGAATTAGATAGTGATGCTGAAGAAGAATAATTAAAGAAGAAGAAA
GAATAGGAAGAAGCTGAAAAATTACAATAGCAAGAAGTTGACCCAGCTGAAAAGCAAAAA
GAAATAGATTAATTTATGGATTCATATCTAGGTATTTTAAAGAAAGGTGCATATGTCAAG
ATGACTATTAGAAATATTTAATTCAAGCACTTCAGAAACTTTAAGCCTGAACATCCTTTA
GTTTTGACTAGAATTAATCCAGGAGAGGACAACTTTGGTTTCCTTAAAGTCAGAATAAAA
AAGCACAGATGGTATAATTCTCTTCTTAAAACATTAGATCCTCTTATTTTCTCTATTGGT
TGGAGAAGATATTAGAGTATCCCTTACTTTGTTTCCCAACAAAGTGATGCACGTATGAGA
TATTTAAAATATACTCCATAATATGAATATTGTGATGCTGTTTTCTATGGTAATTTTGCT
CCTCAAAATACAGGTTTTGTTTGTACTCAAAGTCTTAACAATAAATTAGAGAAATTTAGA
ATTTGTGCTACTGGTGAAGTCCTTGAATTAAATCATACTTTTGATATAGTAAAAAAACTC
AAGCTTGTCGGTGAACCTTTCAAAATATACAAAAATTCCGCCTTCATTAAGGGAATGTTT
AACTCATTCCTAGAAGTTTCTAAATTCGAAGGAGCTCAAATTAAAACACCTTCTGGAATC
AGAGGTTAAATTAAAAAAGCAGTTAAAGAAGGACCTGATGGTTCATTTAGAGCTACATTT
GAAGATAAAATTGTAATGAGTGACTTAGTATTTATGAGAACTTGGTACAAAGTTCCTTTA
GAAAAGTTTTATAATCCTATTATCTCTTATGAAAAGACAAGACTTATGAAAACAACTTGG
GAATTAAGAAAAATGCTCAATATTGATGTTAAGTAAAAGGTCGACAGCGAATACTAAGAA
ATTGAAAGAACTGAAAAGAAATTCAATCCTTTGTTAATACCTAAAAACTTAGAAGAAAAT
CTACCCTTCAAGTCAAAATAAAAGGTTAAGCTACTTTCCAAAAAAGAAAAGTTAGCTAAA
GCAGAATCGAAGATCCCTATAAAAGAGCTTACATCAGAAGAAGATAAAAAAGTATTTGCT
CTTATCTAAAGACTTAATACAATCAAAAAAGAAAAGTTGGCACAAAAAGCATAAAAAACA
GAAGAAAAAAATAAAGTTAAGTAAGCAAGAACAGAAGGAGAAAAGAAAAAATTCCAAGCA
GCTAAAAAAGAATATGAAAAAGAAAAAAATAAAGAAAAATTCACTAAAAAGGCTAAAATG
GCCTAGAAAGCAGCAAACGGAGGTGAATCTGATTGA


>TTHERM_01262830(protein)
MEISDNDSVLSSDNENDVKLKGFDKNLKKDEDSDADDQKKVLASSKAKEKKIKESEEGEK
KPKKIHLRKDKGYADYLIAEEDTSDLPPVTVIVQGPKQSGKTTLIKSLVKTYTKHSIQNV
KGPITVRANKKRRITIIECPNDISGMIDMAKIADIAIILVDASIGFEMETFEFLSLLRAH
GFPSIMGVLTHTDFFKDNKQLRKTKKKYKARFEHEVGNDSKLFYLSGMKYGQYLKREVLN
LSRMIGVMKVQPVPWKQTHPFIVPDRYEHSREGSKVEDNELVDVSFYGWIKGSTFRLNNK
IHIVGLGDYEIDSTDIIEDPVPVVEVKVHEDKKKKEEGSGKQDGQSDGSEGDDESSEESE
DEEENKQEGKKEEPKIKKIKQKRTLKQSEKIVYAPFSNLGFLNYEKSGGYITIPDEHVVF
TKKNQQDVYDDNGELIEQQEDEDLGEGVKMVRDLQDMKKTLNEKLDEDDDVELLDGIELG
EQKKNILEFTAEEKKKLDFKEKQKEIVNLKHKTKDLNQIANAIEQQQSVMATDLQDLIYG
KTDKKICNFDSSNFRSKELYTRDLYKALVKCKFMAGSLIEEEAPEELDSDAEEEQLKKKK
EQEEAEKLQQQEVDPAEKQKEIDQFMDSYLGILKKGAYVKMTIRNIQFKHFRNFKPEHPL
VLTRINPGEDNFGFLKVRIKKHRWYNSLLKTLDPLIFSIGWRRYQSIPYFVSQQSDARMR
YLKYTPQYEYCDAVFYGNFAPQNTGFVCTQSLNNKLEKFRICATGEVLELNHTFDIVKKL
KLVGEPFKIYKNSAFIKGMFNSFLEVSKFEGAQIKTPSGIRGQIKKAVKEGPDGSFRATF
EDKIVMSDLVFMRTWYKVPLEKFYNPIISYEKTRLMKTTWELRKMLNIDVKQKVDSEYQE
IERTEKKFNPLLIPKNLEENLPFKSKQKVKLLSKKEKLAKAESKIPIKELTSEEDKKVFA
LIQRLNTIKKEKLAQKAQKTEEKNKVKQARTEGEKKKFQAAKKEYEKEKNKEKFTKKAKM
AQKAANGGESD


>TTHERM_01262830(gene)
ATGGAAATCAGTGATAACGATAGTGTTTTATCTTCTGATAACGAGAACGACGTTAAGTTA
AAGGGATTTGATAAAAACCTTAAAAAAGATGAAGATTCTGATGCAGATGATTAAAAGAAG
GTATTGGCTTCATCTAAGGCTAAGGAAAAAAAGATAAAGGAATCAGAAGAAGGTGAAAAG
AAACCCAAAAAAATTCATTTAAGAAAAGATAAAGGGTATGCAGACTACCTTATAGCTGAA
GAAGATACTTCCGACCTCCCTCCAGTTACTGTTATTGTTTAAGGTCCAAAGCAGGTAATT
TTTAAAGTCTTGCTTGAGTATTTTATAACAGCAAAGAAATGTAGAATTAGAATCTTAATC
TCACTCACTTATTTTTATAAAAAAGAGTGGTAAAACTACTTTGATAAAGAGTTTAGTAAA
AACATACACTAAGCATAGCATTTAGAATGTTAAAGGTCCTATTACTGTTAGAGCAAATAA
AAAGAGAAGAATTACTATTATTGAATGTCCAAACGATATAAGTGGTATGATCGATATGGC
CAAAATTGCAGATATTGCTATTATATTAGTTGATGCCTCTATTGGTTTCGAAATGGAAAC
ATTCGAATTCCTAAGTTTGCTAAGGGTAATTTATTTTAATTATGGCAAATATTATTGATC
TAAAAACTTTTCTCAGTTAATTAATATTAAACACGATATAAATTCTATAATTAGGCTCAT
GGTTTCCCTTCCATTATGGGAGTTCTTACTCACACTGATTTCTTCAAAGACAATAAATAA
CTTAGAAAAACCAAAAAGAAATATAAAGCTAGATTTGAACATGAAGTTGGCAATGATTCT
AAACTTTTCTATCTCTCTGGTATGAAATATGGCTAATATTTAAAAAGAGAAGTTCTTAAT
TTATCAAGAATGATTGGTGTTATGAAAGTACAACCTGTTCCTTGGAAGTAGACCCACCCA
TTCATCGTCCCTGATAGATACGAACACTCTCGTGAAGGCTCAAAAGTAGAAGATAATGAG
CTTGTTGATGTTAGCTTTTATGGTTGGATAAAAGGCTCAACCTTCCGTTTGAATAACAAG
ATTCACATTGTAGGTAAAAAAAAATATATTTATATCAAACTAAGCCTAAAAAAAATACTC
TACTTATAGCAAAATTTTAATCCCCAGTTTTATAAAGTATTTATGATTTTTTTAATAAAA
TATTAAAGGTTTAGGAGATTATGAAATTGATAGTACTGATATCATCGAAGATCCTGTTCC
TGTTGTAGAAGTTAAAGTACATGAAGATAAAAAGAAAAAAGAGGAAGGAAGTGGTAAATA
GGATGGTTAAAGCGATGGTAGTGAAGGTGATGATGAATCAAGCGAAGAAAGCGAAGATGA
AGAAGAAAATAAATAAGAGGGTAAAAAGGAAGAACCCAAAATTAAAAAAATTAAGCAAAA
AAGAACATTGAAACAATCAGAAAAGATTGTTTATGCCCCTTTCAGTAACTTAGGTTTTTT
GAATTATGAAAAAAGTGGTGGATATATTACTATTCCTGATGAGCACGTTGTCTTTACCAA
AAAAAATTAACAAGATGTTTATGATGATAATGGAGAGTTGATAGAATAAGTAAATAATTT
TTTATAGTTTATTATTTATTTACATTAATTAATAAATAATAAAGTAGGAAGATGAAGATT
TAGGTGAAGGTGTTAAGATGGTTAGAGATTTATAGGATATGAAAAAAACTTTAAATGAAA
AGCTAGATGAAGATGACGATGTTGAACTTCTCGATGGTATCGAATTAGGAGAACAAAAGA
AAAATATTCTTGAATTCACAGCTGAAGAAAAGAAGAAATTAGATTTTAAGGAAAAGCAAA
AAGAAATAGTTAATCTTAAGCACAAGACTAAGGATTTAAATTAAATTGCAAATGCTATAG
AATAATAATAATCAGTTATGGCTACTGATTTACAAGATCTCATTTATGGGTAATTACTTA
TTTCTTTAAGTTTGTTGAAATAAATTCTGAAAAAAATTAATTTTAAAAATTAGTAAAACT
GACAAAAAAATATGCAATTTCGATAGCAGTAACTTTAGAAGTAAAGAATTATACACTAGA
GATTTATATAAGGCCTTAGTAAAATGCAAATTTATGGCTGGCTCATTGATAGAAGAGGAA
GCCCCAGAAGAATTAGATAGTGATGCTGAAGAAGAATAATTAAAGAAGAAGAAAGAATAG
GAAGAAGCTGAAAAATTACAATAGCAAGAAGTTGACCCAGCTGAAAAGCAAAAAGAAATA
GATTAATTTATGGATTCATATCTAGGTATTTTAAAGAAAGGTGCATATGTCAAGATGACT
ATTAGAAATATTTAATTCAAGCACTTCAGAAACTTTAAGCCTGAACATCCTTTAGTTTTG
ACTAGAATTAATCCAGGAGAGGACAACTTTGGTTTCCTTAAAGTCAGAATAAAAAAGCAC
AGATGGTATAATTCTCTTCTTAAAACATTAGATCCTCTTATTTTCTCTATTGGTTGGAGA
AGATATTAGAGTATCCCTTACTTTGTTTCCCAACAAAGTGATGCACGTATGAGATATTTA
AAATATACTCCATAATATGAATATTGTGATGCTGTTTTCTATGGTAATTTTGCTCCTCAA
AATACAGGTTTTGTTTGTACTCAAAGTCTTAACAATAAATTAGTAATTTATAATTCAAAC
AAATATTTACATTTAACTTTTTCCTCATTTCATTAAATTAATTAATTATCTTTTTTAAAT
AAATAGGAGAAATTTAGAATTTGTGCTACTGGTGAAGTCCTTGAATTAAATCATACTTTT
GATATAGTAAAAAAACTCAAGCTTGTCGGTGAACCTTTCAAAATATACAAAAATTCCGCC
TTCATTAAGGGAATGTTTAACTCATTCGTAAAATATTTTAGAATTAATTCATGTTCAGTT
TTTTTAATTAATTTTTTTTACCCTTTACAGCTAGAAGTTTCTAAATTCGAAGGAGCTCAA
ATTAAAACACCTTCTGGAATCAGAGGTTAAATTAAAAAAGCAGTTAAAGAAGGACCTGAT
GGTTCATTTAGAGCTACATTTGAAGATAAAATTGTAATGAGTGACTTAGTATTTATGAGA
ACTTGGTACAAAGTTCCTTTAGAAAAGTTTTATAATCCTATTATCTCTTATGAAAAGTAA
TATCTATCTATCTTTTTTTTGTTTGAGTGTAATTTAATATGTTTTTTTGAATTTTTAGGA
CAAGACTTATGAAAACAACTTGGGAATTAAGAAAAATGCTCAATATTGATGTTAAGTAAA
AGGTCGACAGCGAATACTAAGAAATTGAAAGAACTGAAAAGAAATTCAATCCTTTGTTAA
TACCTAAAAACTTAGAAGAAAATCTACCCTTCAAGTCAAAATAAAAGGTTAAGCTACTTT
CCAAAAAAGAAAAGTTAGCTAAAGCAGAATCGAAGATCCCTATAAAAGAGCTTACATCAG
AAGAAGATAAAAAAGTATTTGCTCTTATCTAAAGACTTAATACAATCAAAAAAGAAAAGG
TAATTTACTAATAATTAATTTAATATGTTTTTGAAATAATTTTATTCTAATCAAAAGTTG
GCACAAAAAGCATAAAAAACAGAAGAAAAAAATAAAGTTAAGTAAGCAAGAACAGAAGGA
GAAAAGAAAAAATTCCAAGCAGCTAAAAAAGAATATGAAAAAGAAAAAAATAAAGAAAAA
TTCACTAAAAAGGCTAAAATGGCCTAGAAAGCAGCAAACGGAGGTGAATCTGATTGA