Identifiers and Description

Gene Model Identifier

TTHERM_01104960

Standard Name

BLT1 (Beta-Like Tubulin)

Aliases

PreTt01888 | 235.m00039

Description

Highly divergent beta-like tubulin; present in very low abundance; localizes to small subset of microtubules; not incorporated into growing ciliary axonemes Genome Browser

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00091 ) Tubulin/FtsZ family, GTPase domain
  • ( PF03953 ) tubulin/FtsZ family, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01104960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_57190
WormBaseWBGene000065389.997093137033517e-262locus:tbb-4 Tubulin beta-4 c
hain status:Partially_confir
med UniProt:P41937 protein
_id:CAA86310.1
Tetrahymena borealisEI9_16521.19.997093137033517e-262tubulin/FtsZ family, GTPase do
main-containing protein (472 a
a)
DictyBaseDDB_G02691969.997093137033517e-262tubB on chromosome: 1 position
3261649 to 3263130
OxytrichaContig8792.0.g749.997093137033517e-262Tubulin/FtsZ family, GTPase do
main
SGDYFL037W9.997093137033517e-262TUB2 Beta-tubulin; associates
with alpha-tubulin (Tub1p and
Tub3p) to form tubulin dimer,
which polymerizes to form micr
otubules

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:11891286: Shang Y, Song X, Bowen J, Corstanje R, Gao Y, Gaertig J, Gorovsky MA (2002) A robust inducible-repressible promoter greatly facilitates gene knockouts, conditional expression, and overexpression of homologous and heterologous genes in Tetrahymena thermophila. Proceedings of the National Academy of Sciences of the United States of America 99(6):3734-9

Sequences

>TTHERM_01104960(coding)
ATGAGAGAAATTGTTTGCATTTCAGCAGGTCAATGCGGTAACTAAATAGGATATAAGTTC
TGGGAAAGAGTTTCTCAAGAGCATGGAGTCGAAGAGACTGGTCTGTATAACGGAAATAAT
GACTTATAGCTCGAGAGAATTGATGTTTACTATAATGAAGGCTCAAGTGGACGTTATGTA
CCTAGATCAGTAATGGTTGATTTGGAACCTGGTGTATTGGATTCAATTCGTGCATCAAAA
TACAGATAACTTTTCCATCCTGATAATTTCATTCACGCTCAAAGTAGCGCTTCTAATAAT
TGGGCTAAGGGACACTATTCTGAAGGTGCTGAACTTTAATAGGAAGTTTTAGATATTGTC
CGTAGAGAAGTTGAAGGTTGTGACAGCCTATAAGGTTTCCAATTCACTCATTCTATTGGT
GGAGGCACTGGAAGTGGTATGGGCACTTTGCTTATTTAAAAGCTTAGAGAAGAATATCCA
GACAGAATTTTTTCAAGTTTTTCTGTTTTCCCATCCGTAAAAGTAAGCGATGTTGTAATT
GAACCTTATAATGCTACATTGAGCATTCATTAGCTCATAGAAAATGTTGACTAATGCATG
GTTATAGATAATGAAGCTTTATACAATATTTGCATGAAAAATTTAAAGATTGAACACCCT
ACTTATGGTGACCTCAATCATATTGTCTCTGTAGCTATGTCTGGTGTTACTTGCAGTATG
AGATTCCCTGGATAATTAAATGCAGATCTCAGAAAATTGTCAGTTAATTTGACTCCCTTC
CCTCGTTTACACTTCTTTACAGTTGGAATAGCTCCTTTATATGGAAGAGGATAGGCTTAG
TTTGCCAGTAAATATGATGTTCCTGAAATTCTTTAGCAAGCTTTTAATCCTCACAATATG
ATGTGTGCTGCCGATGTTTCTCATGGAAAATATTTAACAGCTGCTCTTGCTTTTAGAGGA
AAAGTATCATCATATGAAATCGAAAAGCAACTACTAAACTTCTAACAAAAAAATAGCAAC
CGTTTTACAGAATGGATTCCAAACAGTATGAAGCTAAGTATGTGCGATATATCCTTGGAA
TAAGTACCAAGAAGCGCTGTTTTAATAAGTAATAACACATCGATATAAGAAGTATTCAAA
AGAATAAATGCTTAATATACAAGCATGTTTAGAAGAAAGGCTTTCGTTCACTGGTATTTA
GATGAAGGTATGGACGAAATGGAGTTTAATGAAGCAGAAGCTAATATGAATGACTTGGTG
AGTGAATATCAATAATACTAAGATTCAACCGTAGACAGTGAAGAAGAAATTGACTTAGAT
TAGACATAGGCAACATTTGGAGAAAGATAAGAAAAACAAAATAAAAAATGTAACTCAAAA
TAACAATCTAATATTGCTTCATCAAATGAAATTTGA


>TTHERM_01104960(protein)
MREIVCISAGQCGNQIGYKFWERVSQEHGVEETGLYNGNNDLQLERIDVYYNEGSSGRYV
PRSVMVDLEPGVLDSIRASKYRQLFHPDNFIHAQSSASNNWAKGHYSEGAELQQEVLDIV
RREVEGCDSLQGFQFTHSIGGGTGSGMGTLLIQKLREEYPDRIFSSFSVFPSVKVSDVVI
EPYNATLSIHQLIENVDQCMVIDNEALYNICMKNLKIEHPTYGDLNHIVSVAMSGVTCSM
RFPGQLNADLRKLSVNLTPFPRLHFFTVGIAPLYGRGQAQFASKYDVPEILQQAFNPHNM
MCAADVSHGKYLTAALAFRGKVSSYEIEKQLLNFQQKNSNRFTEWIPNSMKLSMCDISLE
QVPRSAVLISNNTSIQEVFKRINAQYTSMFRRKAFVHWYLDEGMDEMEFNEAEANMNDLV
SEYQQYQDSTVDSEEEIDLDQTQATFGERQEKQNKKCNSKQQSNIASSNEI


>TTHERM_01104960(gene)
ATGAGAGAAATTGTTTGCATTTCAGCAGGTCAATGCGGTAACTAAATAGGATATAAGTTC
TGGGAAAGAGTTTCTCAAGAGCATGGAGTCGAAGAGACTGGTCTGTATAACGGAAATAAT
GACTTATAGCTCGAGAGAATTGATGTTTACTATAATGAAGGCTCAAGTGGACGTTATGTA
CCTAGATCAGTAATGGTTGATTTGGAACCTGGTGTATTGGATTCAATTCGTGCATCAAAA
TACAGATAACTTTTCCATCCTGATAATTTCATTCACGCTCAAAGTAGCGCTTCTAATAAT
TGGGCTAAGGGACACTATTCTGAAGGTGCTGAACTTTAATAGGAAGTTTTAGATATTGTC
CGTAGAGAAGTTGAAGGTTGTGACAGCCTATAAGGTTTCCAATTCACTCATTCTATTGGT
GGAGGCACTGGAAGTGGTATGGGCACTTTGCTTATTTAAAAGCTTAGAGAAGAATATCCA
GACAGAATTTTTTCAAGTTTTTCTGTTTTCCCATCCGTAAAAGTAAGCGATGTTGTAATT
GAACCTTATAATGCTACATTGAGCATTCATTAGCTCATAGAAAATGTTGACTAATGCATG
GTTATAGATAATGAAGCTTTATACAATATTTGCATGAAAAATTTAAAGATTGAACACCCT
ACTTATGGTGACCTCAATCATATTGTCTCTGTAGCTATGTCTGGTGTTACTTGCAGTATG
AGATTCCCTGGATAATTAAATGCAGATCTCAGAAAATTGTCAGTTAATTTGACTCCCTTC
CCTCGTTTACACTTCTTTACAGTTGGAATAGCTCCTTTATATGGAAGAGGATAGGCTTAG
TTTGCCAGTAAATATGATGTTCCTGAAATTCTTTAGCAAGCTTTTAATCCTCACAATATG
ATGTGTGCTGCCGATGTTTCTCATGGAAAATATTTAACAGCTGCTCTTGCTTTTAGAGGA
AAAGTATCATCATATGAAATCGAAAAGCAACTACTAAACTTCTAACAAAAAAATAGCAAC
CGTTTTACAGAATGGATTCCAAACAGTATGAAGCTAAGTATGTGCGATATATCCTTGGAA
TAAGTACCAAGAAGCGCTGTTTTAATAAGTAATAACACATCGATATAAGAAGTATTCAAA
AGAATAAATGCTTAATATACAAGCATGTTTAGAAGAAAGGCTTTCGTTCACTGGTATTTA
GATGAAGGTATGGACGAAATGGAGTTTAATGAAGCAGAAGCTAATATGAATGACTTGGTG
AGTGAATATCAATAATACTAAGATTCAACCGTAGACAGTGAAGAAGAAATTGACTTAGAT
TAGACATAGGCAACATTTGGAGAAAGATAAGAAAAACAAAATAAAAAATGTAACTCAAAA
TAACAATCTAATATTGCTTCATCAAATGAAATTTGA