Identifiers and Description

Gene Model Identifier

TTHERM_00460720

Standard Name

BIME1 (BIvalents in MEiosis)

Aliases

PreTt25723 | 54.m00179 | 3823.m01093

Description

The protein has a function in meiotic crossing over and bivalent formation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00460720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

Paragraph NoGene NameParagraph Text
113BIME1The protein localizes to an elusive meiotic chromosome axis. In a BIME1 deletion, chiasma frequency is reduced to about one third of that in the wild type. In the paper by Shodhan et al. (2017), Bime1 protein is referred to by its old name Sa15.

Associated Literature

  1. Ref:28100637: Shodhan A, Kataoka K, Mochizuki K, Novatchkova M, Loidl J (2017) A Zip3-like protein plays a role in crossover formation in the SC-less meiosis of the protist Tetrahymena. Molecular biology of the cell 28(6):825-833
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  3. Ref:26205990: Hayashi A, Mochizuki K (2015) Targeted Gene Disruption by Ectopic Induction of DNA Elimination in Tetrahymena. Genetics 201(1):55-64

Sequences

>TTHERM_00460720(coding)
ATGAGTTGGTCTTCTTAAACAGACTCATAAGTCAACAATATAGACAATTTAGATTGGTAT
AGCAGTTTTTTTTAGAATGACTATATGGAGAATAATTATATCGAAGAGCTGAATTAGCAA
GAAATTTCAAATCCACTTACATGCAAGCATGATATCAATGCAAATTAGGTCAATTCTACT
AAATTAAATTCTTCTATTCAGTAAAATATATACACGATACAAGAAGAGTCTTAAGAAAAT
ATTCAAAATCAAGCCTCAAAAAAAAATTTAAGCACATTTAACACTCCAAGAAACAAATCA
CAAGTTAATGATATTCAGAATTTAGTTCATGATTACTAAGATAATTCAAACTAATTGTAA
AAAACTAATTCCAAATTCATTTTACAAAACAATCAAAGCGAAGATTTAGAAATTCTAAGT
AAAGACTTAGAAATTTAAAAGTAAAACACTGATGATACAGCTAAAAATAAGGATGAAAGC
TAAATAAAGCAAAATTTTAGCTAAAGTAGATTAATATTAGTAGAAAATAAAAATGAAGAA
GAAATCATTCAGAAAGAAGCAGATTAGTAGAAATAAAGCAGTAAATAATAAGATGATTAT
ATTTAAGAAGAAATTCAATAAAAAGTATCTTGCTATTAACCTTAATAGTAATAATAAATA
ACAGAAATTAATCATAAGGAAAATGAAATAGAATTACATATCAAGAAAAAAAACAGTTCA
AAAAAAATGTAGTAATAAAACAAAGATTTCATTTTAGATTGCTTTATTCATATTCCCAGC
AAAGTATAAAAGTAGAAAAATGGGGAATGCCAGATGAGTGAGAAAAAAAAAGATGTTTAA
AAAGAAGAAAATACATTCATTAAAAAACAAAATCTTCATCAAAATTTAATCTAAATCAAT
TAGTATTTTGATGGAATGAAATTCAATTTGCAAAAGAGCTTTACATTTAAGACTGATGAA
AAAGAAAATTGTAAACTAAATTATGTCAAAGCTAACATAAATCAATTAAAGTCATAAATT
AATTTTGATAATGAAAAGTAATCTCAGAGCAGCTAATTGCATTAAAAAAATACTTGCAAT
CTTAATCTAAATAACTAAAAAGTTGAATAAAAAAAAGAAAAAAGTCAAAAAATTGAAATT
TTTGAAAAAAATATTTTATAAGCCTAAAACAAAGATGTAAATATTTTTTTACCTGAACTG
GTGTTTGAAAAAAGCCAAAAAACCAAATAAAAAAGGATGCCAAATGAAGAAAATGGCAAC
TATTTTTCGTAAATTAACATTAAAAAACAAACAAATTAGGATTAAATAAGAGAAAAAACT
AAAAGCTAAACATTCAAAGAAAAATCAAGTTAGAATGAGTTCCATATTAGTAAGAATTTA
AATTTTGATAATATTTTTAATGAGAAGGCAAAAAGATCTGAAATATCCTTTAAATTTTAG
AATGAATTTCAAAATTTAAGTTAAGACTAAAAATGTTTACAAATAAATAATTTGGATTTT
AGAAATAAAAATTTATTGAAAACTTTAAAGAAATTTCAAGATTAATTCAGTTCAATAAAT
GATCGGCTAGACTCTATTCTATAAAAAAGTATAGAGTAGAAATGGGAAGCACAGTACCTT
TAAGAAGAGAAAAATAACATCACTAAAGACATTCATGATATTACATAAATTATTAAAAAA
ATAATTTGA


>TTHERM_00460720(protein)
MSWSSQTDSQVNNIDNLDWYSSFFQNDYMENNYIEELNQQEISNPLTCKHDINANQVNST
KLNSSIQQNIYTIQEESQENIQNQASKKNLSTFNTPRNKSQVNDIQNLVHDYQDNSNQLQ
KTNSKFILQNNQSEDLEILSKDLEIQKQNTDDTAKNKDESQIKQNFSQSRLILVENKNEE
EIIQKEADQQKQSSKQQDDYIQEEIQQKVSCYQPQQQQQITEINHKENEIELHIKKKNSS
KKMQQQNKDFILDCFIHIPSKVQKQKNGECQMSEKKKDVQKEENTFIKKQNLHQNLIQIN
QYFDGMKFNLQKSFTFKTDEKENCKLNYVKANINQLKSQINFDNEKQSQSSQLHQKNTCN
LNLNNQKVEQKKEKSQKIEIFEKNILQAQNKDVNIFLPELVFEKSQKTKQKRMPNEENGN
YFSQINIKKQTNQDQIREKTKSQTFKEKSSQNEFHISKNLNFDNIFNEKAKRSEISFKFQ
NEFQNLSQDQKCLQINNLDFRNKNLLKTLKKFQDQFSSINDRLDSILQKSIEQKWEAQYL
QEEKNNITKDIHDITQIIKKII


>TTHERM_00460720(gene)
ATGAGTTGGTCTTCTTAAACAGACTCATAAGTCAACAATATAGACAATTTAGATTGGTAT
AGCAGTTTTTTTTAGAATGACTATATGGAGAATAATTATATCGAAGAGCTGAATTAGCAA
GAAATTTCAAATCCACTTACATGCAAGCATGATATCAATGCAAATTAGGTCAATTCTACT
AAATTAAATTCTTCTATTCAGTAAAATATATACACGATACAAGAAGAGTCTTAAGAAAAT
ATTCAAAATCAAGCCTCAAAAAAAAATTTAAGCACATTTAACACTCCAAGAAACAAATCA
CAAGTTAATGATATTCAGAATTTAGTTCATGATTACTAAGATAATTCAAACTAATTGTAA
AAAACTAATTCCAAATTCATTTTACAAAACAATCAAAGCGAAGATTTAGAAATTCTAAGT
AAAGACTTAGAAATTTAAAAGTAAAACACTGATGATACAGCTAAAAATAAGGATGAAAGC
TAAATAAAGCAAAATTTTAGCTAAAGTAGATTAATATTAGTAGAAAATAAAAATGAAGAA
GAAATCATTCAGAAAGAAGCAGATTAGTAGAAATAAAGCAGTAAATAATAAGATGATTAT
ATTTAAGAAGAAATTCAATAAAAAGTATCTTGCTATTAACCTTAATAGTAATAATAAATA
ACAGAAATTAATCATAAGGAAAATGAAATAGAATTACATATCAAGAAAAAAAACAGTTCA
AAAAAAATGTAGTAATAAAACAAAGATTTCATTTTAGATTGCTTTATTCATATTCCCAGC
AAAGTATAAAAGTAGAAAAATGGGGAATGCCAGATGAGTGAGAAAAAAAAAGATGTTTAA
AAAGAAGAAAATACATTCATTAAAAAACAAAATCTTCATCAAAATTTAATCTAAATCAAT
TAGTATTTTGATGGAATGAAATTCAATTTGCAAAAGAGCTTTACATTTAAGACTGATGAA
AAAGAAAATTGTAAACTAAATTATGTCAAAGCTAACATAAATCAATTAAAGTCATAAATT
AATTTTGATAATGAAAAGTAATCTCAGAGCAGCTAATTGCATTAAAAAAATACTTGCAAT
CTTAATCTAAATAACTAAAAAGTTGAATAAAAAAAAGAAAAAAGTCAAAAAATTGAAATT
TTTGAAAAAAATATTTTATAAGCCTAAAACAAAGATGTAAATATTTTTTTACCTGAACTG
GTGTTTGAAAAAAGCCAAAAAACCAAATAAAAAAGGATGCCAAATGAAGAAAATGGCAAC
TATTTTTCGTAAATTAACATTAAAAAACAAACAAATTAGGATTAAATAAGAGAAAAAACT
AAAAGCTAAACATTCAAAGAAAAATCAAGTTAGAATGAGTTCCATATTAGTAAGAATTTA
AATTTTGATAATATTTTTAATGAGAAGGCAAAAAGATCTGAAATATCCTTTAAATTTTAG
AATGAATTTCAGTAAATTTTATTTATTTTTATTAATTGAAATAAAAGTTTATTCTTTAAA
GAAATTTAAGTTAAGACTAAAAATGTTTACAAATAAATAATTTGGATTTTAGAAATAAAA
ATTTATTGAAAACTTTAAAGAAATTTCAAGATTAATTCAGTTCAATAAATGATCGGCTAG
ACTCTATTCTATGTAAATTATTTTTTTTTATTAAGAAATTTTATAATTTTATTAAATAGA
AAAAAGTATAGAGTAGAAATGGGAAGCACAGTACCTTTAAGAAGAGAAAAATAACATCAC
TAAAGACATTCATGATATTACATAAATTATTAAAAAAATAATTTGA