Identifiers and Description

Gene Model Identifier

TTHERM_00703920

Standard Name

BBC82

Aliases

PreTt20168 | 110.m00141

Description

EF hand family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.2%

TetraMine Data

TTHERM_00703920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15267.19.997093137033517e-262EF hand family protein (583 aa
)
OxytrichaContig605.1.g943.0011595823640496e-94EF-hand domain pair
Stentor CoeruleusSteCoe_291181.2160992992528256e-37
WormBaseWBGene000002880.00000030014504373857585locus:cal-4 status:Confirmed
UniProt:G5EDZ8 protein_id
:CAZ65521.1
DictyBaseDDB_G02691040.00020003864201578029calB on chromosome: 1 position
2981116 to 2981944

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00703920(coding)
ATGTTATAATATCGCACTTTGAACAGGTTATCTAACTTAATTTAGGCCGTTGCAGAAGGT
GAATAGAAGACTGAAGTTATTCGTTAAGTCCTCGCTGAGCAAAGACACTTTGAGCCTTAA
TCCGCTTTCCGTAGACTCGACCAAACTAAGACTGGCTAACTCTCTGCCACTGATTTAATT
GACTTCTTAGAACAAAACAAAATTTTGGTCAGCCACAAAGAAGCTATTTAACTCCTTCGC
ATCCTTGATCTTAATGGTGATGGTCGTGTCACTTATGCAGATTTTGCAGAAAGCATTTTG
CCTTAAGAAGATGCCAGACTCAAGTAAATTGCCAATTTAAGAGAAGGCTATTACTTAGAA
GATGGTGAAAGTTTACCTTATGAAGCTGAATGGTCTCTCGCCAGAGTCCTTGAATAGGAA
GTCAAGAATTATAGAAATATAGAATCATTGAAGGACATCTTGTGCAGTTCTTACGATTTC
AACAAGCTTGATTTATTCAATGCTATTGATGATGTCCGCACTGGCTCCCTTACAATCTCT
GCCGTTGATGAATTTATGAGATCTCAAGGTAAAGTATTGAGCCAAGATTAATTACTTGCT
TTCTTCAGAAGAGTTAGCAACACTAACGTTATTAGCTATCCTCAATTCGTAGAAATCATT
ACTCCTGTTGAACCCTCTCCTTCTTACATTGCTAACAGCTCACGTCTTGGTTCTTCTTCT
CGTGGTTTCAGACAATCTAACTTAAACAGAAGCATTTATAACACTCCATCAAGATTGACT
TCTAGCAAAGCTTTCTAAGATGCTGAAAAGGACATCGGATATCAAGACTATCTTGCAAGA
TCTGCTAGCTTAGAAAAGCTTAGAAACAGTCACTACTCACCTGCTAGAAGATCTAACTAT
GGCTCTCCTGTTAGATATACCACCTAATAAAGATCTCCTTACCATACTCCCAGCAAAGAC
CTTGCTCTTACCCAAAGCATGTACGGAAGTGCTTCAAAGGGATTCCACTAAACAGCCACT
TCTAACCTTAACATTTCTAAATCACCTATGAGAGGAAATGAAGAAGAACACCTTGTCAGA
GCCTTGAAAGAATAAATTGTACTTGATAGAGATGTAGAAGAATTGAAGAATCAATTATCT
TTTAGACACGACTTCAATGCTGAAGATGCCTTCAGAATTTTCGACAAGAAAGCAAGAGGA
TACATTTCTAAATTTGAATTTGAACTTTCTCTTAACGACATCGGTATCTACCCAACCAAG
GACGAGTTACACTTATTCTACAAGAGATATGATAGAGATAATGATGGATTATTAAAATTC
AGCGATTTCTCTGAATTAGTTACACCTGCTAGCATTGAATATGCTGCCTTGAGCAAGAGC
AGAGTTCCAAACTATCTCAATCCCGATGATGGTTTGATTAATTTCTCTCTTGAAACCAGA
AGACTTTACAAAAAACTTTTGAATAAGATTTTCCAAGCTGAAATCGAAGCTGAATATATC
CGTTAAAAGCTTTCCAGAAGACCTTTGTTTTCTTTATACGATGCATTTTTGGCTATTGAT
AACCTTGAAAATGGCTTCATCACTCTTAATGATTTTAAGGCTATCCTCTAAGATTATGGT
ATTTTTGTCTCTACAAATGACTTATAAACTCTAATCAAGAGATACGATAAGAACCAAGAC
AATAGAGTCACTTTCCCTGAATTTATGAATGAACTTACTCCTAAATCTCCTGTTAAGCAA
TTTTGA


>TTHERM_00703920(protein)
MLQYRTLNRLSNLIQAVAEGEQKTEVIRQVLAEQRHFEPQSAFRRLDQTKTGQLSATDLI
DFLEQNKILVSHKEAIQLLRILDLNGDGRVTYADFAESILPQEDARLKQIANLREGYYLE
DGESLPYEAEWSLARVLEQEVKNYRNIESLKDILCSSYDFNKLDLFNAIDDVRTGSLTIS
AVDEFMRSQGKVLSQDQLLAFFRRVSNTNVISYPQFVEIITPVEPSPSYIANSSRLGSSS
RGFRQSNLNRSIYNTPSRLTSSKAFQDAEKDIGYQDYLARSASLEKLRNSHYSPARRSNY
GSPVRYTTQQRSPYHTPSKDLALTQSMYGSASKGFHQTATSNLNISKSPMRGNEEEHLVR
ALKEQIVLDRDVEELKNQLSFRHDFNAEDAFRIFDKKARGYISKFEFELSLNDIGIYPTK
DELHLFYKRYDRDNDGLLKFSDFSELVTPASIEYAALSKSRVPNYLNPDDGLINFSLETR
RLYKKLLNKIFQAEIEAEYIRQKLSRRPLFSLYDAFLAIDNLENGFITLNDFKAILQDYG
IFVSTNDLQTLIKRYDKNQDNRVTFPEFMNELTPKSPVKQF


>TTHERM_00703920(gene)
ATGTTATAATATCGCACTTTGAACAGGTTATCTAACTTAATTTAGGCCGTTGCAGAAGGT
GAATAGAAGACTGAAGTTATTCGTTAAGTCCTCGCTGAGCAAAGACACTTTGAGCCTTAA
TCCGCTTTCCGTAGACTCGACCAAACTAAGACTGGCTAACTCTCTGCCACTGATTTAATT
GACTTCTTAGAACAAAACAAAATTTTGGTCAGCCACAAAGAAGCTATTTAACTCCTTCGC
ATCCTTGATCTTAATGGTGATGGTCGTGTCACTTATGCAGAGTAATTAAATATTTTCAAT
TTCATAAATGAACTCTCCTTTCAAAATCTCTATTGCTTTATTTATCAAGAAAATTAATTA
ATTTTTTTCTTAAAAATAGTTTTGCAGAAAGCATTTTGCCTTAAGAAGATGCCAGACTCA
AGTAAATTGCCAATTTAAGAGAAGGCTATTACTTAGAAGATGGTGAAAGTTTACCGTAAA
TTAAATAGTTTCCTTTGTTTTTACTAAATTAAATACTCAGTATTTGCATTAAATTTTATT
TTGCAATTCAAATAGTTATGAAGCTGAATGGTCTCTCGCCAGAGTCCTTGAATAGGAAGT
CAAGAATTATAGAAATATAGAATCATTGAAGGACATCTTGTGCAGTTCTTACGATTTCAA
CAAGCTTGATTTATTCAATGCTATTGATGATGTCCGCACTGGCTCCCTTACAATCTCTGC
GTAATTTTTTTATAACTTATTTAATTAGAAATTCAGAATAAAAACTTTTTAAAAAGACTA
AGATGAAATGTTTTATTTAGCATTACTTAACTAATTAGCCATTAAATATGAAAAAATTAA
CATTTTTTTAAAGCAGATAAAATAAATTTTTAGTTATTTTATGATTGAATGCAAAAAAAA
TGATAATTTAACTGAATTTTATATAAATAGCGTTGATGAATTTATGAGATCTCAAGGTAA
AGTATTGAGCCAAGATTAATTACTTGCTTTCTTCAGAAGAGTTAGCAACACTAACGTTAT
TAGCTATCCTCAATTCGTAGAAATCATTACTCCTGTTGAACCCTCTCCTTCTTACATTGC
TAACAGCTCACGTCTTGGTTCTTCTTCTCGTGGTTTCAGACAATCTAACTTAAACAGTAA
ATTTTTTATAGAAAAATTTAATTGAAACTATAAAAATTACTCCTTTTTCAATTTTTATAG
GAAGCATTTATAACACTCCATCAAGATTGACTTCTAGCAAAGCTTTCTAAGATGCTGAAA
AGGACATCGGATATCAAGACTATCTTGCAAGATCTGCTAGCTTAGAAAAGCTTAGAAACA
GTCACTACTCACCTGCTAGAAGATCTAACTATGGCTCTCCTGTTAGATATACCACCTAAT
AAAGATCTCCTTACCATACTCCCAGCAAAGACCTTGCTCTTACCCAAAGCATGTACGGAA
GTGCTTCAAAGGGATTCCACTAAACAGCCACTTCTAACCTTAACATTTCTAAATCACCTA
TGAGAGGAAATGAAGAAGAACACCTTGTCAGAGCCTTGAAAGAATAAATTGTACTTGATA
GAGATGTAGAAGAATTGAAGAATCAATTATCTTTTAGACACGACTTCAATGCTGAAGATG
CCTTCAGAATTTTCGACAAGAAAGCAAGAGGATACATTTCTAAATTTGAATTTGAACTTT
CTCTTAACGACATCGGTAATAAAAATTATTTTAATAAATTAGAATAATCTAGCTAGAATT
AAGCTAACAAATAGATTACAAAATAAAATTCAAACAAGTAAACCTGTAGAAAATAAAAAT
TAAATTATAAATAGGTATCTACCCAACCAAGGACGAGTTACACTTATTCTACAAGAGATA
TGATAGAGATAATGATGGATTATTAAAATTCAGCGATTTCTCTGAATTAGTTACACCTGC
TAGCATTGAATATGCTGCCTTGAGCAAGAGCAGAGTTCCAAACTATCTCAATCCCGATGA
TGGTTTGATTAATTTCTCTCTTGAAACCAGAAGACTTTACAAAAAACTTTTGAATAAGAT
TTTCCAAGCTGAAATCGAAGCTGAATATATCCGTTAAAAGCTTTCCAGAAGACCTTTGTT
TTCTTTATACGATGCATTTTTGGCTATTGATAACCTTGAAAATGGCTTCATCACTCTTAA
TGATTTTAAGGCTATCCTCTAAGATTATGGTATTTTTGTCTCTACAAATGACTTATAAAC
TCTAATCAAGAGATACGATAAGAACCAAGACAATAGAGTCACTTTCCCTGAATTTATGAA
TGAACTTACTCCTAAATCTCCTGTTAAGCAATTTTGA