Identifiers and Description

Gene Model Identifier

TTHERM_00220710

Standard Name

BBC78

Aliases

PreTt22399 | 18.m00475 | 3701.m00182

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 16.1%

TetraMine Data

TTHERM_00220710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06757.11.0001043265246556e-154hypothetical protein (234 aa)
OxytrichaContig22507.0.g75.9981191891941984e-64short chain dehydrogenase
WormBaseWBGene000113982.00017271388466e-38locus:qdpr-1 status:Confirme
d UniProt:Q9XVJ3 protein_i
d:CAB03278.1
Stentor CoeruleusSteCoe_309482.6786369618080778e-33
DictyBaseDDB_G02726849.99723014177113e-33qdpr on chromosome: 2 position
1985270 to 1986069

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00220710(coding)
ATGGCTTCATAAAGAACATTATTAGTTATAGGAGGTTGTGGAAATTTAGGTCGCTCTGTT
ATTAGCAAATTTAAGAGTAACTGGAACATAGCTAGCATTGGTCTTAATATTAATAATGAA
TCAAATAAAAATATTATCCTACCTCAAAATTAATCAGCATCTTAGTATGTCAGTGAAGTC
AAATAGTAATTGAAAAGCTTCAGTCCTTCCTACGATGCTATAATTTGCGTAGCAGGTGGA
TGGAATGGAGGGTCAATTAAAGACTCTAACGTTTTTGAAACTTATCATAAGATGCACTCA
GTTAATGTTATTCCTTCCATTTTAGCTGCTCATCTTTCAACTCATTTTTTGAGGAAAAAT
GGTCTTCTTGTTTTTACTGGTGCTGGCGGCATCATAAATAATCCTTGCCATGACATGATT
GGATATGGTCTTTCTAAAGTTGCTGTTCATTCTTTAGCTTCAACAATGGCTGTTTCAAAA
GATATGCCAGAAGGTTCTACTGTAGTAACAATTTTACCAAAGGTTATTGATACTCCTTAA
AATAGAGAAGCTATGCCTGATTCAGATTTTAGCACATGGGCAAAGCCAGAATAAATTTCA
GGACTTTTAAAAATGTGGGCTGAGGGCAACAATCTTCCTAAAACAGGATCATTTGCTATG
CTCAATGTGTAAAATGGTAGTGTAGTTCCTGAATTTATTTGA


>TTHERM_00220710(protein)
MASQRTLLVIGGCGNLGRSVISKFKSNWNIASIGLNINNESNKNIILPQNQSASQYVSEV
KQQLKSFSPSYDAIICVAGGWNGGSIKDSNVFETYHKMHSVNVIPSILAAHLSTHFLRKN
GLLVFTGAGGIINNPCHDMIGYGLSKVAVHSLASTMAVSKDMPEGSTVVTILPKVIDTPQ
NREAMPDSDFSTWAKPEQISGLLKMWAEGNNLPKTGSFAMLNVQNGSVVPEFI


>TTHERM_00220710(gene)
ATGGCTTCATAAAGAACATTATTAGTTATAGGAGGTTGTGGAAATTTAGGTAAATTACCT
TTGTTATTAATTGCGTTTCTGCAATCAATTTTTATTTTTAAAAATTAAGGTCGCTCTGTT
ATTAGCAAATTTAAGAGTAACTGGAACATAGCTAGCATTGGTCTTAATATTAATAATGAA
TCAAATAAAAATATTATCCTACCTCAAAATTAATCAGCATCTTAGTATGTCAGTGAAGTC
AAATAGTAATTGAAAAGCTTCAGTCCTTCCTACGATGCTATAATTTGCGTAGCAGGTGGA
TGGAATGGAGGGTCAATTAAAGACTCTAACGTTTTTGAAACTTATCATAAGATGCACTCA
GTTAATGTTATTCCTTCCATTTTAGGTAAAGAATTAGCTTAGTTAATTTAAAAATAAGCA
AATAAAAATAATAAATATTATAGCTGCTCATCTTTCAACTCATTTTTTGAGGAAAAATGG
TCTTCTTGTTTTTACTGGTGCTGGCGGCATCATAAATAATCCTTGCCATGACATGATTGG
ATATGGTCTTTCTAAAGTTGCTGTTCATTCTTTAGCTTCAACAATGGTAGATTATTTGAT
ATAAAATAATTCTATTAAACATAGAATAAATATAAAATACATTTTTGTATTATTGATTTT
AATATTTTTTTGTTTACAAATTAGGCTGTTTCAAAAGATATGCCAGAAGGTTCTACTGTA
GTAACAATTTTACCGTAATTTTATTTGGTTAAATTTATTAATTAATTTAATACTCTATTA
TATATTTAGAAAGGTTATTGATACTCCTTAAAATAGAGAAGCTATGCCTGATTCAGATTT
TAGCACATGGGCAAAGCCAGAATAAATTTCAGGACTTTTAAAAATGTGGGCTGAGGGCAA
CAATCTTCCTAAAACAGGATCATTTGCTATGCTCAATGTGTAAAATGGTAGTGTAGTTCC
TGAATTTATTTGA