Identifiers and Description

Gene Model Identifier

TTHERM_00143690

Standard Name

BBC73

Aliases

PreTt26676 | 11.m00373 | 3702.m00096

Description

EF hand family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00143690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_269630
Tetrahymena borealisEI9_04801.19.997093137033517e-262EF hand family protein (614 aa
)
OxytrichaContig10932.0.g1109.997093137033517e-262Repeat of unknown function (DU
F1126)
WormBaseWBGene000130283.9992896861436003e-19status:Partially_confirmed U
niProt:Q9XWW8 protein_id:CAA
21520.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00143690(coding)
ATGAATTATAACTTACCTAAGACTGTTCCTTTATTGCCAGGTCACTGCTTCCCTGACCAC
TTAAAGGAAAGCCATCATAAGACTTAATAGTTCACCTTAGTCAATAACGTTCATTGCGAA
AAAACTAATTACATCGAAGAAAAGAACGACCCCTATCTTATTGATTCACTAAGAATGGGC
ACTCCTCCTGATTTGACATATGGAAAAAGAAAGGCTCCCATAAATGATTATATCCCTCGT
ATCCAACCTCCCTGGTTAAAATATGATAGATAAGTTCTTCGTTTTTATTGCTATTTCTAG
GAAAGTGTTGTTGAAAATCCTTATGAAAATTACCGTATCCGTAAGTGTACTCTTTACTAC
TACTTATCTGACGGTACTATTCATGTCAACGAACCTAAAATAATGAATTCTGGTATTGAA
TAAGGTGTCTTTATTAAGCGTCAATAAATTCCTAAATAACTAAATTCAACTGACTACTAC
ACCTGGGAAGATCTTAATGTTGGAATAAATATTAATCTCTTTGAAAGAGTCTTTAGAATT
GTTGACTGTGATTCTTTCACTAAAGAATTCTTCGTTTATATGGGAAAGAAAATGAATTCA
CCTGAAAGAGTCCCTAATGATGCATTTGAAGCTTAAAAAACTTTGAAGGACATTAAAATT
CCTCCTCCTAACACTAAAGAATATAACGAGTACAATGAAGTAAAGCTTGGAGGTGGACAT
CCCAATACTGGATTACAAAAGTATCTTGAAAATGACAGAAAGGTTCTTTCTTTCAATGTT
CTTTGGAACGATACAAGCTTAGAAGGTGGTCTCAATTACTATATTCTAAACTATTTCTTA
GCTGACGACACCACTGAAATTAAGGAAATTAAGAGACACAATAGTGGTAAAGATGCTTTC
CCATTATTTTTATGCAGAAAGAAGTTACCTAAGGAACCCATTATGACTCATTATCCTGGT
ATGACTTTGAAAAAGGAAGAATACTACAGTCCCTCTGATTTAGTTTGTGGAAATATGGTT
AGAATTTACAACAAAGATTGTTTAATCTTCAACTGCGATGCTTACACAAAGGAATGGTAC
TTACAAAATATGAACTTGCAACAAATTCCTATTACCCTCAAAAAGGAAGATATTAAACGT
TTCTATTAACCAGTTCCTCCATATAATGGTTTTGGTAGTGAAGCTGATTCTTTAGGAAGT
GTTTACAATCTCTAACCTAAAGCTCCTCGCAAAGACATCAATAAAATGTATACATAAGAT
CAATATATTCTTCGTTTCGAAGGAAAGCTAATTTCATAGAACAAAGAAGACAACCATAGA
AAGTTCATTATTTCATTCTTCTGTGGTGATGACACTATCATGGTTTACGAAACTGCTGAT
AAAAATTCAGGTATTTGGGGAGGTAAATTCTTAGAAAGAATGAATCACAACAATCCTATC
AATAATAAGCCTTACACTGAACTTGATTTCTAAATCGGTGAGATTATATAACTCGGAGTT
TATCGCTTCTAATTGCTCAGAGCTGATGAATATACTCATAAATACATGAAATCTAAACCT
GAAGTCTTTAAGGAGGCTGATATTGAGTATACTCTTAATCATCTTAGAAAATTCGCTACT
AAATACAAATCTTACGATGAATTTATGGTACTTCTAATCAAAAATATTGATCCTAACCGT
AGAGGAGTTATTGATTTCAATGATTTCGTTGTTGGTTTAAGAAGACTTGGCTACAATCTA
ACTTATCAAGAAATTTATACACTCATGCGTTATTTCGATCTTGACGAAAATTGGAAACTT
GATGTTAAATCTCTTTTCGTTGCCCTTGGTGGAAAACAATGA


>TTHERM_00143690(protein)
MNYNLPKTVPLLPGHCFPDHLKESHHKTQQFTLVNNVHCEKTNYIEEKNDPYLIDSLRMG
TPPDLTYGKRKAPINDYIPRIQPPWLKYDRQVLRFYCYFQESVVENPYENYRIRKCTLYY
YLSDGTIHVNEPKIMNSGIEQGVFIKRQQIPKQLNSTDYYTWEDLNVGININLFERVFRI
VDCDSFTKEFFVYMGKKMNSPERVPNDAFEAQKTLKDIKIPPPNTKEYNEYNEVKLGGGH
PNTGLQKYLENDRKVLSFNVLWNDTSLEGGLNYYILNYFLADDTTEIKEIKRHNSGKDAF
PLFLCRKKLPKEPIMTHYPGMTLKKEEYYSPSDLVCGNMVRIYNKDCLIFNCDAYTKEWY
LQNMNLQQIPITLKKEDIKRFYQPVPPYNGFGSEADSLGSVYNLQPKAPRKDINKMYTQD
QYILRFEGKLISQNKEDNHRKFIISFFCGDDTIMVYETADKNSGIWGGKFLERMNHNNPI
NNKPYTELDFQIGEIIQLGVYRFQLLRADEYTHKYMKSKPEVFKEADIEYTLNHLRKFAT
KYKSYDEFMVLLIKNIDPNRRGVIDFNDFVVGLRRLGYNLTYQEIYTLMRYFDLDENWKL
DVKSLFVALGGKQ


>TTHERM_00143690(gene)
ATGAATTATAACTTACCTAAGACTGTTCCTTTATTGCCAGGTCACTGCTTCCCTGACCAC
TTAAAGGAAAGCCATCATAAGACTTAATAGTTCACCTTAGTCAATAACGTTCATTGCGAA
AAAACTAATTACATCGAAGAAAAGAACGACCCCTATCTTATTGATTCACTAAGAATGGGC
ACTCCTCCTGATTTGACATATGGAAAAAGTAAGATTTTTTAAAGTATCTTTGTCACACTT
GTCGAATAACATTTTAATATTAGTTTTATTTCATTTTAAGTGGCTACTTTAGATCATTTA
ATTAATCAATTAGTGTGAATCAACTACTTATAGCAATTTTTTAACGTTTGATTGAAATAT
AATATTAGGAAAGGCTCCCATAAATGATTATATCCCTCGTATCCAACCTCCCTGGTTAAA
ATATGATAGATAAGTTCTTCGTTTTTATTGCTATTTCTAGGAAAGTGTTGTTGAAAATCC
TTATGAAAATTACCGTATCCGTAAGTGTACTCTTTACTACTACTTATCTGACGGTACTAT
TCATGTCAACGAACCTAAAATAATGAATTCTGGTATTGAATAAGGTGTCTTTATTAAGCG
TCAATAAATTCCTAAATAACTAAATTCAACTGACTACTACACCTGGGAAGATCTTAATGT
TGGTAACTATTTATTTATTTCAATATTTCAAAGCATACATATAATATTGAAGAAGGCTTA
CAAATATAGATATATATTTTTATAAAAATTTAAAATACGAAACTTCCTCAATTTTGATTA
TTCATCAACACTCTTTATTTTAAGAAAAAACTATATTTTAATTGGCAGAGAGTTTGATTT
TTTGTTAGGATATATCCTTTTTTTTTTGATTTTTTTAATTTATAATAAATGTTGCATTTA
AAATGCTTTGCTGCAATTATTAAATTTATTAATATTCAATAAATTAAGCAAGCATAAGTT
ATATAATTAATTCTAAGTTGTCATTAATTACTCCTTTCTCACCATTCATTTAAAAATTAC
AATTTAAACTAACTGTTCTTTTAAACAAATAAAAATATTTTTTGTATTTTCTGTAGGAAT
AAATATTAATCTCTTTGAAAGAGTCTTTAGAATTGTTGACTGTGATTCTTTCACTAAAGA
ATTCTTCGTTTATATGGGAAAGAAAATGAATTCACCTGAAAGAGTCCCTAATGATGCATT
TGAAGCTTAAAAAACTTTGAAGGACATTAAAATTCCTCCTCCTAACACTAAAGAATATAA
CGAGTACAATGAAGTAAAGCTTGGAGGTGGACATCCCAATACTGGATTACAAAAGTATCT
TGAAAATGACAGAAAGGTAAATAAAATTTTACCAAAAACATTTAAAATATTTTTTATAAT
AAATATAAATAATTAGGTTCTTTCTTTCAATGTTCTTTGGAACGATACAAGCTTAGAAGG
TGGTCTCAATTACTATATTCTAAACTATTTCTTAGCTGACGACACCACTGAAATTAAGGA
AATTAAGAGACACAATAGTGGTAAAGATGCTTTCCCATTATTTTTATGCAGAAAGAAGTT
ACCTAAGGTATTCATTTTATTTTGAAAAATCTATTTTATTAAATACCAAAAAGACCAAAT
CCATTACCTACCAAGTTAAAATACAATAATATTTGAAAAATGATTAGCAATTAATACTCT
CTTTGATAAATAACTATTAGCACAATTAAAAAATTAAAATGGTAGTCTTTATAAAGCAAT
AAATAAATATTATGAAATATAAAATATCTTTAAAAAATTGTAAAATTATTTTATCTTAAT
TAAAAAGGAACCCATTATGACTCATTATCCTGGTATGACTTTGAAAAAGGAAGAATACTA
CAGTCCCTCTGATTTAGTTTGTGGAAATATGGTTAGAATTTACAACAAAGATTGTTTAAT
CTTCAACTGCGATGCTTACACAAAGGAATGGTACTTACAAAATATGAACTTGCAACAAAT
TCCTATTACCCTCAAAAAGGAAGATATTAAACGTTTCTATTAACCAGTTCCTCCATATAA
TGGTTTTGGTAGTGAAGCTGATTCTTTAGGAAGTGTTTACAATCTCTAACCTAAAGCTCC
TCGCAAAGACATCAATAAAATGTATACATAAGATCAATATATTCTTCGTTTCGAAGGAAA
GCTAATTTCATAGAACAAAGAAGACAACCATAGAAAGTTCATTATTTCATTCTTCTGTGG
TGATGACACTATCATGGTTTACGAAACTGCTGATAAAAATTCAGGTATTTGGGGAGGTAA
ATTCTTAGAAAGAATGAATCACAACAATCCTATCAATAATAAGCCTTACACTGAACTTGA
TTTCTAAATCGGTGAGATTATATAACTCGGAGTTTATCGCTTCTAATTGCTCAGAGCTGA
TGAATATACTCATAAATACATGAAATCTAAACCTGAAGTCTTTAAGGAGGCTGATATTGA
GTATACTCTTAATCATCTTAGAAAATTCGCTACTAAATACAAATCTTACGATGAATTTAT
GGTACTTCTAATCAAAAATATTGATCCTAACCGTAGAGGAGTTATTGATTTCAATGATTT
CGTTGTTGGTTTAAGAAGACTTGGCTACAATCTAACTTATCAAGAAATTTATACACTCAT
GCGTTATTTCGATCTTGACGAAAATTGGAAACTTGATGTTAAATCTCTTTTCGTTGCCCT
TGGTGGAAAACAATGA