Identifiers and Description

Gene Model Identifier

TTHERM_00155380

Standard Name

BBC57

Aliases

PreTt28328 | 13.m00287 | 3829.m01136

Description

conserved hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00155380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05225.19.997093137033517e-262hypothetical protein (493 aa)
OxytrichaContig1726.0.g291.9998099689916736e-77EF-hand domain pair
Stentor CoeruleusSteCoe_315422.2273635617957438e-39

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00155380(coding)
ATGCACAATTATAATGTTGATAGAAAATATTAATATAACTGCCGTATCGGTAATTGGAGC
GAAGAATGGGAGTTAGATGAATACAAGATGAAAGAATACTTAAAAAACAAGGAAAAGCAA
AAATTGGTCTCAACTGATAAAGAGGACAGATTAAAGAGAAGCTTAGGAGGCGTTAATTTG
TCTTACGCTAATGAAGGGCTAGTTAAATTTGGATATACTGTTATGATTGAGAGTGATTTT
ATGAATGCAGTAGTAGCTTCAAATATTTGGGATAAGATCACTGGAACAGAAGAAGCTTAC
GGTGTAACAGTCACTAGTTAGAAAGAGCCTATTGTAAGAACAGCATTCTAATTATTAAGA
TATGAATAGGATTAATACTAAGATGATGTTATTCACTATGGATAAAATTTCAAAATTGCT
GTTATTAGTCGTCTCTCTGAAAAGCCTTTATATTTGACTAGCTCTCATATTACTCCTTAA
AAGTGTGCAAAGTTCTCTCGTAAATAAGAAGTTTCAATTTCAACAAACGAGGGCATTAAT
TCTGCTTGGTGCTTCGAGTATATGGATCCTAAGTTAAGATATGAAATGAAAGGCTAGCCA
GTACGTTCAGGTGAACCAGTTTTAATTAAGCACATTCCTACTTGTTAATGGCTTGCAACT
GATAACGTTTAATACAATAATGAATTTGGATAAGAATTCGAAGTATTTTGTAACTCTTAT
TAATGCCACAATAAAACTTAGAATTTAATAGCTGAAAAAGTTGGTCGTAAGACAATCGAA
ACTCCTATGAGAAACTAAACAAATTAAAACACATTCAGAATTGTTACTGCTTTGTACCCT
TCATAAGAAACTCAATAAAACTTCGAAGCTTCTTATAGCTAAACTCTACCTCGTAGAAGA
GTTGAAATTAACAAAGCTGATTTACTTAATAAATTACGTAGAGCTTTGATTAATAAAAAT
GGATCAAATGGACTTTTGTTCTTCAAAAATGAATTATTAAAATAAGATAAAGATAATTCA
GGTTATCTCCCTTAACAATAATTCAAATAAACAGTCTAATGCCACGGAATTAATTTCAGT
GATTTAGATATTAAAGAGGTTATACAATCATTCTAAGAATTAGACAATAAGATTAATTAC
AGTGAACTTCTCATTTAATTAAAGGGAACCTTAAGTGAAAAAAGAAGAAATTTGATTAAT
CTAGCTTATGATGTTTTGGCAGAAAAGCTTGGTTAAAATGTCACTTTAAGTGGAATTTTC
AGTGCTTTTAATAAGATAAGACATCCTGATGTTGTTAAAAAGTATGGAACTGATAAGGAA
ATCTTCAACAATTTTGTTTTGAGCTGGGGAAATTTGAATCCTCACATTGCTATTTCTCGC
GAATAATTTGAATCTTATTATCACGATTTCAGTGCTTGCGTAGACAAAGAAGACTATTTC
GAAGTCGTACTAAAGAATAGTTGGGATATACCCAATTGA


>TTHERM_00155380(protein)
MHNYNVDRKYQYNCRIGNWSEEWELDEYKMKEYLKNKEKQKLVSTDKEDRLKRSLGGVNL
SYANEGLVKFGYTVMIESDFMNAVVASNIWDKITGTEEAYGVTVTSQKEPIVRTAFQLLR
YEQDQYQDDVIHYGQNFKIAVISRLSEKPLYLTSSHITPQKCAKFSRKQEVSISTNEGIN
SAWCFEYMDPKLRYEMKGQPVRSGEPVLIKHIPTCQWLATDNVQYNNEFGQEFEVFCNSY
QCHNKTQNLIAEKVGRKTIETPMRNQTNQNTFRIVTALYPSQETQQNFEASYSQTLPRRR
VEINKADLLNKLRRALINKNGSNGLLFFKNELLKQDKDNSGYLPQQQFKQTVQCHGINFS
DLDIKEVIQSFQELDNKINYSELLIQLKGTLSEKRRNLINLAYDVLAEKLGQNVTLSGIF
SAFNKIRHPDVVKKYGTDKEIFNNFVLSWGNLNPHIAISREQFESYYHDFSACVDKEDYF
EVVLKNSWDIPN


>TTHERM_00155380(gene)
ATGCACAATTATAATGTTGATAGAAAATATTAATATAACTGCCGTATCGGTAATTGGAGC
GAAGAATGGGAGTTAGATGAATACAAGTATTTTTATTTAATAGCTAAATTATTAGATTAT
AAATATCATAAAGAGATTGTTTGCTATTTTTAAACTAACCAAATTTTATCAAAGTTAAAT
GCAACTATTTTTTTTAATAGGATGAAAGAATACTTAAAAAACAAGGAAAAGCAAAAATTG
GTCTCAACTGATAAAGAGGACAGATTAAAGAGAAGCTTAGGAGGCGTAATGATTTATTTT
GTTTCAATATTTATATTTGCGAATGATAATTAAATTTATAAATTTAAAAGGTTAATTTGT
CTTACGCTAATGAAGGGCTAGTTAAATTTGGATATACTGTTATGATTGAGAGTGATTTTA
TGAATGCAGTAGTAGGTAATCCTTATTTTTTTATTTTAAATTCAAATTTTATAGGTTCCA
TTGTTAAAAAGCTTCAAATATTTGGGATAAGATCACTGGAACAGAAGAAGCTTACGGTGT
AACAGTCACTAGTTAGAAAGAGCCTATTGTAAGAACAGCATTCTAATTATTAAGGTTTTA
TATTTTTTTTCTACTCTAAAATAATAATAAAATAAATTTTTTTGTCTATGTTTTTATTAG
ATATGAATAGGATTAATACTAAGATGATGTTATTCACTATGGATAAAATTTCAAAATTGC
TGTTATTAGTCGTCTCTCTGAAAAGCCTGTAAATAATTATTTTAACATAAAATTCTCAAT
TATATTTTATTGATTAAAAAAAATTTTAAATAAAAGTTTTAAAAAAATATTTTTTAAATT
TTTAATTGTTTCCTCATTTAAAAACATTAAAAGCAAATAAATTAATAAATTAGCTTTGTC
AATTTTTATTGTTGCAAAATCAGAATGACTTTGTTAAAAAAATAATTTTTTTAAATTATA
AAAGTTATATTTGACTAGCTCTCATATTACTCCTTAAAAGTGTGCAAAGTTCTCTCGTAA
ATAAGAAGTTTCAATTTCAACAAACGAGGGCATTAATTCTGCTTGGTGCTTCGAGTATAT
GGATCCTAAGTTAAGATATGAAATGAAAGGCTAGCCAGTACGTTCAGGTGAACCAGTTTT
AATTAAGCACATTCCTACTTGTTAATGGCTTGCAACTGATAACGTTTAATACAATAATGA
ATTTGGATAAGAATTCGAAGTATTTTGTAACTCTTATTAATGCCACAATAAAACTTAGAA
TTTAATAGCTGAAAAAGTTGGTCGTAAGACAATCGAAACTCCTATGAGAAACTAAACAAA
TTAAAACACATTCAGAATTGTTACTGCTTTGTACCCTTCATAAGAAACTCAATAAAACTT
CGAAGCTTCTTATAGCTAAACTCTACCTCGTAGAAGAGTTGAAATTAACAAAGCTGATTT
ACTTAATAAATTACGTAGAGCTTTGATTAATAAAAATGGATCAAATGGACTTTTGTTCTT
CAAAAATGAATTATTAAAATAAGATAAAGATAATTCAGGTTATCTCCCTTAACAATAATT
CAAATAAACAGTCTAATGCCACGGAATTAATTTCAGTGATTTAGTAATTAATTATCATTA
ATTGTTATACTTTAAACAATTTCAAATAATCAGAAATTTTTATTTTAATTTTGGGATGGC
ATCAAAGAAATATAGCAGCAAAAATAAATTATAAATTATTTACTGTAGAGGCTGTAACAC
TAGATAAATTACAGTTTTTTGTTTGAATAAAAAGCCAATTTGATTATAAATTGTTGCTAG
TCAAAAATTACAATTAAAGCTATAATATATAAAAATTAATTAACTATTTTGAGAGATAAA
AAATGCAAACATTTCAATTGATTAGTAAAAAAATTGACTATTAATAGAAATGTAATTAAA
TCTGCTTAAAATCTCGTTTGAGTTTTAATTAAAAAGATTAACTTTTTCTATCTATTCCAA
AATTAAAAAAACTTTGGTATGTTCGAAAGTGGTCTTTAAAATTTAAAAAATACTTAGATT
AAAATAGAAGAATTCAAATTAATCAATTGTATTTACACAAATCAAAATTAAAATAATGTG
AATAATTAAAATGATAAAAGACCTATTATACTATATTAAAATTTATTAATGAGAGTTAAA
ACTTAGTTGAGTTATTCTAAAAGAAATTAATTTTCACATTTTGATATTGTATTAAAACAT
ATGTTTTTTTTATCAATAGGATATTAAAGAGGTTATACAATCATTCTAAGAATTAGACAA
TAAGATTAATTACAGTGAACTTCTCATTTAATTAAAGGTAACTATTTATTTATTTTCTTT
TTTTTATCTTTTTATTCTTTCAATATCTTTTGTTGATATATTTATTGCACACCACATTAA
ATTTAGTAAATTTTCATTATTCTCGAATTTCAAATCATTTGTTGATATTTTATTTGTGTA
TATGATTATTTTCATTTAAAATTGCTTTAACATAATAATTAATCTTACTTACGCTTTAAT
TTAATTATTGAAGGGAACCTTAAGTGAAAAAAGAAGAAATTTGATTAATCTAGCTTATGA
TGTTTTGGCAGAAAAGCTTGGTTAAAATGTCACTTTAAGTGGAATTTTCAGTGCTTTTAA
TAAGATAAGACATCCTGATGTTGTTAAAAAGTATGGAACTGATAAGGAAATCTTCAACAA
TTTTGTTTTGAGCTGGGGAAATTTGAATCCTCACATTGCTATTTCTCGCGAATAATTTGA
ATCTTATTATCACGTATAGCGATTTACTTATTAATTTTATTGGAAAATATTTAACACTAT
TGATTTAATTTATTACTTTACTTCTAAAATATCTTGAATCATATTACGCTTTTCTAGATA
TTTACATTAATTTGCAGCTTGATTGCTTATTTTATAATTTATTATTTTATTATTAGGATT
TCAGTGCTTGCGTAGACAAAGAAGACTATTTCGAAGTCGTACTAAAGAATAGTTGGGATA
TACCCAATTGA