Identifiers and Description

Gene Model Identifier

TTHERM_00016360

Standard Name

BBC53

Aliases

PreTt11942 | 1.m00990

Description

Regulator of chromosome condensation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 46.8%

TetraMine Data

TTHERM_00016360

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02617.19.997093137033517e-262regulator-chromosome condensat
ion (406 aa)
OxytrichaContig1238.1.g1288.998739065740874e-48Regulator of chromosome conden
sation (RCC1) repeat
Stentor CoeruleusSteCoe_281631.9287498479639178e-22
DictyBaseDDB_G02675865.999654353873483e-20DDB_G0267586 on chromosome: 1
position 375348 to 376736
WormBaseWBGene000216857.003160085026828e-16locus:herc-1 status:Confirme
d UniProt:Q9BL11 protein_i
d:CCD73459.1
SGDYGL097W0.000008000552149328928SRM1 Nucleotide exchange facto
r for Gsp1p, localizes to the
nucleus, required for nucleocy
toplasmic trafficking of macro
molecules; suppressor of the p
heromone response pathway; pot
entially phosphorylated by Cdc
28p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000090

Sequences

>TTHERM_00016360(coding)
ATGTATTTATTTATGCATTTATGTATGTGCTTTTGTATGATTTCTTCAAGTTAAAAGAAA
GAAAAATTGAATAAGGGGAAAAATAAACAAATTAAGTTAAATAAAAAGAAAGAAAAACAA
AATAAAAAGATTGAAATAATAAAAAAAGAAAAGGAAAGAAGATCGAATCCGCAAATGATT
TCAAAAACCTAGGCCTTCGCAAGATTATTCCAATTGAGTTCAAAATCATTCTCTACTGTC
AAGGGTGGAAATTTATACACTTGGGGCTAATACGCCAGTGGTACCGGTTTCGAGACCGCC
TCTGCTGTCCCCAGAAAGGTTGATTACTTCTCAGGCAATGTCTCCAAGGTTGCTATGGGT
CCTTATCACACTGCCGTTATTACCAACGACGGTTCTTTATACACTTTTGGTTGGGGTTAA
AACGGTGCTCTCGGTAATGGTGCTAAGGAATTCTAATTATCTCCCAGCCCTGTCAGCTTC
TTCAACGATAAGAAACTCAAGGTTAAGGACGTCGTAGTTGGTGAAAGCTACACTATTGCC
GTCACTGAAAATGGTGAAGTTTACTCCTGGGGTTATGGTGGTGAACCTTCCAGCAAGATC
AACCTTGACTTCTTCAGAAACGCTATTTTACCTCAAAGATGTGGTGCTTTGGGATCTGGA
GATAACAAGAATAGATTAACTCCCTAATAAATTGCTAACTTGAAGGCAGACGGATACAAG
AATATTTCTGGTGGTGACAACTTTGCTACTTTGGTCAATTAATCTGGTGAAGTTATTAAC
TGGGGTACTGGTCTTTTCGGTTCTTTGGGTAACGGAAGCGACTATCCTTTATTCACTCCT
GAAGTTAACGCTTACTTCAAGCACTTGAAGGAACACGAAGGACTCACTGTTTAATCCATT
AAATCTGCTGGTCACTTCTCTGCTGCCTTATTATCTAACGGTAAATTATACACTTTCGGT
GTTAACACTCAAGGCTAATTAGGTATCCGTGAAAACCTTGGTCACAACACTGACTAAAAT
GCTCGTCTCCCTACCCCTGTTGTTGACAGACACTTTGTTGGTCAAAAGGTTGTTGACTTC
GAAGTTGGTGAGAACACCCTCGTCTTCCTTACTGATAAAAACGAAGTCTTCTTCAGTGGT
TTGGAATTAGCTTATTAACCCATCAGATGGGAAATCCCTACTGACAAGAAGATTGTCAAG
CTTGCTGCCTCTAAGGACACTTTTGCTGCCGTCACTGGTAATTAATTAATTAATTTTTTG
TTTAAATTAAAATTTTATTTAAAAAAATAGAAACTGGTAAAATTTATTAATTCAACGAAT
TCGTTGGTGTCTCCACTAATGAAGTTGGTAACGATTACAATGTTGCTGATAGCAAGGCTT
TCGAAGGCAAGGTTGTTGATCTTGGTGGTTCTTATGGTATTAGATTTGCTATTGTCAACT
GAAAAACCTAATGAAGAATTTGATTATTTCACCAACTCCAATTAGCTAATATTGAAGTTG
GTTTCTAAGAAGCAACAAACAAACAAATTTCACTAAAACATAAATTATTAAATCGCTATT
TCGAATATTTTTTCTCATTTCAATCTATGTTTATTAAGAAAAAATGATCAATTAAATTAT
TCAAAATAGCATTTTCATATTTGTTTTTGTATCTTTATTACAAATTTAAAAGGAAACTTA
ATAAAAACTCTCTCACTTCTATATTACTTACTAAACATTTTATTTATTGAAAATTAATTT
GAAACGAATAAAATATATCAAATTGCTAATATTTAACAGACTAAAAAATGCATTCACAAG
ATTATTTAGTTTCAAAGCAAATAGTTAAAAAAAACCTAAAAAATTATCAAATAAAATTTA
TTTTACAAAGATAAAAAATTAGTTTGCTTAATTTTTTAAACTCATTTACAACTTTTCTGT
TTTTTTTAGATAAAATCAATTCTTTAAATCTGCTTTAATACTAATCAATTAATACAAACT
TACATACTGTAAAATAAAAAATATTTAATTATTATTTGTTATACTTTTATATCTCAAAAA
TACAATCAAATTTTTTGA


>TTHERM_00016360(protein)
MYLFMHLCMCFCMISSSQKKEKLNKGKNKQIKLNKKKEKQNKKIEIIKKEKERRSNPQMI
SKTQAFARLFQLSSKSFSTVKGGNLYTWGQYASGTGFETASAVPRKVDYFSGNVSKVAMG
PYHTAVITNDGSLYTFGWGQNGALGNGAKEFQLSPSPVSFFNDKKLKVKDVVVGESYTIA
VTENGEVYSWGYGGEPSSKINLDFFRNAILPQRCGALGSGDNKNRLTPQQIANLKADGYK
NISGGDNFATLVNQSGEVINWGTGLFGSLGNGSDYPLFTPEVNAYFKHLKEHEGLTVQSI
KSAGHFSAALLSNGKLYTFGVNTQGQLGIRENLGHNTDQNARLPTPVVDRHFVGQKVVDF
EVGENTLVFLTDKNEVFFSGLELAYQPIRWEIPTDKKIVKLAASKDTFAAVTGNQLINFL
FKLKFYLKKQKLVKFINSTNSLVSPLMKLVTITMLLIARLSKARLLILVVLMVLDLLLST
EKPNEEFDYFTNSNQLILKLVSKKQQTNKFHQNINYQIAISNIFSHFNLCLLRKNDQLNY
SKQHFHICFCIFITNLKGNLIKTLSLLYYLLNILFIENQFETNKIYQIANIQQTKKCIHK
IIQFQSKQLKKTQKIIKQNLFYKDKKLVCLIFQTHLQLFCFFQIKSILQICFNTNQLIQT
YILQNKKYLIIICYTFISQKYNQIF


>TTHERM_00016360(gene)
ATGTATTTATTTATGCATTTATGTATGTGCTTTTGTATGATTTCTTCAAGTTAAAAGAAA
GAAAAATTGAATAAGGGGAAAAATAAACAAATTAAGTTAAATAAAAAGAAAGAAAAACAA
AATAAAAAGATTGAAATAATAAAAAAAGAAAAGGAAAGAAGATCGAATCCGCAAATGATT
TCAAAAACCTAGGCCTTCGCAAGATTATTCCAATTGAGTTCAAAATCATTCTCTACTGTC
AAGGGTTGGGCATTTCAAAAATTAGTTTAGTATATACGCAGCTTGCTTGCGCCTCATCTA
TCTTTGCAAAAATTAAATAGGATTATCTGAAAAAAAGGCTTTTTTTCTTTGATTTTATAT
CTTATCAGAAGAGTCTATTCATTCATATTAAAGAAAGTCTGTCTGTCTTATTTAATTGAG
TGTTCTTTCTGCTTTGTATGCAAATCCTATACAAATAAGTAGCTTATTAGTAATACATTG
ATAGATGAGGTCGTAGGCAATCTCGATCAAATAAATATAAAACAAAGCTTTAAATTATTA
GCATTAGCAGCAAACTATTTAGTATCATATTTCAATCCCTTAATCCTCTTTTTCATATAT
CAAAAGGTGGAAATTTATACACTTGGGGCTAATACGCCAGTGGTACCGGTTTCGAGACCG
CCTCTGCTGTCCCCAGAAAGGTTGATTACTTCTCAGGCAATGTCTCCAAGGTTGCTATGG
GTCCTTATCACACTGCCGTTATTACCAGTAAATATTAGCATTGCATTTCGTATTTATAAA
AGTTTACTTTAGTAGCTTTATTCTCAATTAGCAAATAGATAGCGAAATTAAATTAAATCA
ATGATCATTTTTTATTTTGAATTAATGTTGATTTATTAAATTGAAAAAATAAATATATAG
ACGACGGTTCTTTATACACTTTTGGTTGGGGTTAAAACGGTGCTCTCGGTAATGGTGCTA
AGGAATTCTAATTATCTCCCAGCCCTGTCAGCTTCTTCAACGATAAGAAACTCAAGGTTA
AGGACGTCGTAGTTGGTGAAAGCTACACTATTGCCGTCACTGGTAAGAATAGCATTTATG
AATATTTATTTGTTCTGATTGTTTGAAACAATAAATTTATTTATTTTTATCGTTAATCAC
TATTCTAACATATTTAAAGAAAATGGTGAAGTTTACTCCTGGGGTTATGGTGGTGAACCT
TCCAGCAAGATCAACCTTGACTTCTTCAGAAACGCTATTTTACCTCAAAGTAAGATATTT
AACAAATAAATAGTCTAACTTGCTTGTTTGTTTGCTTGTTTAGATAAGATTTAAAATTTG
CAATAAGATCCTAAATATATATATATATATGTACTTACGTACCTAATTCATACATTCTAA
CAAAGATATAAGATAATAGTAAAAATTTTAGCAAAGCATGTAGTTAAAGAAATAAATGGG
AATGATATCATTATGTAATTATTATATAGTGTTTACCTATAGTAAAAAAGCCTAGTTTTA
ACCACCAACCAAAACATTTAATAGGTATACTTGCAGTCTCTAATTTAGGTTTGTTTCTTC
ATAATCATTTAGTAAGAAAGCAAAAAGAAAGATAGATTTTACAATATTCAACTATTCAAT
AGATATTAAATAAGCATTTTAGATAGATTAGATATAAAATAAAAAAATAGAATGATAGAT
TAGATTGCTACGTAGTTATTTAGATAAATAGATAGTTAGATAGACTAAATCAAATCTTTA
TTATTTGAAATATTTCAAAAAATAGTTCTCAGAAAATATAGTCATAATTATTAGCAAGAA
AACAACCAAATATATCTTCTTAATGTAGAATTAACAGATAGAATGAAAGAAATATAGATA
GATAGATGGATACATACATTCATACTAAATAATTTTTATTTAGAGGAAATAAATGTGTTG
GTTGAACTAACTATTTTTGGAAAGAGCAAAATAAATGTTGATAAATGTTTAATATATAAA
AATATATATATTCAAATGGATAGGAATTGAGAATTAGATAAAGATTAGGGATAATCAGTT
CAATAATTTGCAACTTTAAGATATTAAAATAAACAAATTAGAATTTCAAACGACAAACAC
ATACATATACATATAAAATTTAATATAATAGAATTAAAAATGATTGCATCCAAAATAATG
AATAATGAATTAAATAAATTAATGTCTAAATAAATGAATAAATAAGCAAGCAAACATACA
AATTTTTTACTTAGAATTAAAATTTTAAATGTTGTTTGAATTAAAAAATTAATAATCTAA
ATAGGATGTGGTGCTTTGGGATCTGGAGATAACAAGAATAGATTAACTCCCTAATAAATT
GCTAACTTGAAGGCAGACGGATACAAGAATATTTCTGGTGGTGACAACTTTGCTACTTTG
GTCAATTAATCTGGTGAAGTTATTAACTGGGGTACTGGTCTTTTCGGTTCTTTGGGTAAC
GGAAGCGACTATCCTTTATTCACTCCTGAAGTTAACGCTTACTTCAAGCACTTGAAGGAA
CACGAAGGACTCACTGTTTAATCCATTAAATCTGCTGGTCACTTCTCTGCTGCCTTATTA
TCTAACGGTAAATTATACACTTTCGGTGTTAACACTCAAGGCTAATTAGGTATCCGTGAA
AACCTTGGTCACAACACTGACTAAAATGCTCGTCTCCCTACCCCTGTTGTTGACAGACAC
TTTGTTGGTCAAAAGGTTGTTGACTTCGAAGTTGGTGAGAACACCCTCGTCTTCCTTACT
GGTAATAACAATTTTTTTTTCAAGTAATTTTGTTTATTGTTATTTAAAAATTAAAGATAA
AAACGAAGTCTTCTTCAGTGGTTTGGAATTAGCTTATTAACCCATCAGATGGGAAATCCC
TACTGACAAGAAGATTGTCAAGCTTGCTGCCTCTAAGGACACTTTTGCTGCCGTCACTGG
TAATTAATTAATTAATTTTTTGTTTAAATTAAAATTTTATTTAAAAAAATAGAAACTGGT
AAAATTTATTAATTCAACGAATTCGTTGGTGTCTCCACTAATGAAGTTGGTAACGATTAC
AATGTTGCTGATAGCAAGGCTTTCGAAGGCAAGGTTGTTGATCTTGGTGGTTCTTATGGT
ATTAGATTTGCTATTGTCAACTGAAAAACCTAATGAAGAATTTGATTATTTCACCAACTC
CAATTAGCTAATATTGAAGTTGGTTTCTAAGAAGCAACAAACAAACAAATTTCACTAAAA
CATAAATTATTAAATCGCTATTTCGAATATTTTTTCTCATTTCAATCTATGTTTATTAAG
AAAAAATGATCAATTAAATTATTCAAAATAGCATTTTCATATTTGTTTTTGTATCTTTAT
TACAAATTTAAAAGGAAACTTAATAAAAACTCTCTCACTTCTATATTACTTACTAAACAT
TTTATTTATTGAAAATTAATTTGAAACGAATAAAATATATCAAATTGCTAATATTTAACA
GACTAAAAAATGCATTCACAAGATTATTTAGTTTCAAAGCAAATAGTTAAAAAAAACCTA
AAAAATTATCAAATAAAATTTATTTTACAAAGATAAAAAATTAGTTTGCTTAATTTTTTA
AACTCATTTACAACTTTTCTGTTTTTTTTAGATAAAATCAATTCTTTAAATCTGCTTTAA
TACTAATCAATTAATACAAACTTACATACTGTAAAATAAAAAATATTTAATTATTATTTG
TTATACTTTTATATCTCAAAAATACAATCAAATTTTTTGA