Identifiers and Description

Gene Model Identifier

TTHERM_00219350

Standard Name

BBC52

Aliases

PreTt22363 | 18.m00389 | 3701.m00148

Description

EF hand family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00219350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06713.19.997093137033517e-262EF hand family protein (479 aa
)
OxytrichaContig242.1.g22.998957050488393e-103EF-hand domain pair
Stentor CoeruleusSteCoe_315422.506567475899953e-46
SGDYGL106W0.0004000184047659232MLC1 Essential light chain for
Myo1p, light chain for Myo2p;
stabilizes Myo2p by binding t
o the neck region; interacts w
ith Myo1p, Iqg1p, and Myo2p to
coordinate formation and cont
raction of the actomyosin ring
with targeted membrane deposi
tion
WormBaseWBGene000068610.0007003012208360162locus:cal-5 status:Confirmed
UniProt:Q18136 protein_id
:CCD65556.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00219350(coding)
ATGAATCAAGGATAAGGAAGCATTCCATAAAAATATCGCCACTAAGTTCGTATAGGAAAC
TGGAGCGAAGAGTGGGAATTAGAAAAAATAAGATTCAAAGATTATTTAGCTACATAAACT
AAAACATCAATTGCATAATAAAAGATCGAAGCTGGTCATCAAAAAGCTTCTCTCACTTAT
TCAAGAGATGGTTACATTCATTTTGGAGATAGAATTATGCTTTATAATGATAAGACAAGA
GGTTATTTAGTTTGTGATATTTGGGAAAAATATAACTAAATAGATGAAAGCTATCCTGTG
TCTACAACTGGAAAGACCTTCCCATGTGCACGCTCTATTTTCTTAATACAACCTTGCCCT
GAAGATTACAATCCTAGATAAAACATCTTGTGCTATGGATAGAAATTTAAGATTGTTGTC
AATCCTAGAATGTTTAGAAAACCACTCTACTTATCTAGCTAGCCTGCTGATCCTTAAAGA
AGTAAAAAAAACTCAAGACAATAAGATTCATTCCTTTCTTCCAAGGATAATTTTGATTCT
GTTTGGGTTGTTGAGCATATTGACCCTTAAATTAGATTTGAAATGAATAAATAACCTGTT
AGAGCAAATGATCCTATAATCTTAAAACACTTCTAAACAAATTAGTACTTAGCAAGTGAT
GAGTAGTAAGTGAAGAACACTTATGGAATTGAAAACGAAGTTTTTGCTCTTTAATATTAA
ACATATAACAAAACATAAAATTTAATTGCTGAAAAGATGGGAAGAACTACAATTGATATT
CCTATGAGAAACTAGCATTCTTAAAACACTTGGTGTCTTGTTACAGCTGATGATCCAATC
TTAGAATTTGATGAGAGTGTTCTTGATCGTATAGAAACTCCTAAAGACATAGTTTAAAAG
TTACGCTATTAAATATCTGCAAGAGGATTCTTCAGTTTAAGAGGTCTTGATTTTATTTTT
AGAGATATGGACTAATAAAAAACAGGTTAACTTGAATATGACGATTTCCGTTGGGGTTTA
AGAAACTTTGGAATACAATCAACACCAGAAGAAGTTAAATTATTAATGGAAGCTTATGAT
AAAAATCTTAATGGATATGTTGATTATCAAGAATTTATTTCATCTCTGAGAGGAAGCTTA
TCTGACAGAAGAAGTGATTTAGTTTCAAAAGCTTTTGAAAAAATATAGCAATAGTATGGA
GTAGTAAATTTAGAAACTATTGGTAAGGCTTACAAAGCACACAAATACACAGATGTTGTA
AGAGGTCAAAAATCTGCAAAGTAACATTTCGATGAATTCATAAAGGAATGGTAGATAAAA
GATTTATTGAAACCAATTTCAAAATTAGAATTTATCCTTTTCTATCAAGATGTCAGTGCA
CTCATTGATAGAGAAGAATAGTTTGATTCTTTAATTAAATAAACTTGGGAATTGTGA


>TTHERM_00219350(protein)
MNQGQGSIPQKYRHQVRIGNWSEEWELEKIRFKDYLATQTKTSIAQQKIEAGHQKASLTY
SRDGYIHFGDRIMLYNDKTRGYLVCDIWEKYNQIDESYPVSTTGKTFPCARSIFLIQPCP
EDYNPRQNILCYGQKFKIVVNPRMFRKPLYLSSQPADPQRSKKNSRQQDSFLSSKDNFDS
VWVVEHIDPQIRFEMNKQPVRANDPIILKHFQTNQYLASDEQQVKNTYGIENEVFALQYQ
TYNKTQNLIAEKMGRTTIDIPMRNQHSQNTWCLVTADDPILEFDESVLDRIETPKDIVQK
LRYQISARGFFSLRGLDFIFRDMDQQKTGQLEYDDFRWGLRNFGIQSTPEEVKLLMEAYD
KNLNGYVDYQEFISSLRGSLSDRRSDLVSKAFEKIQQQYGVVNLETIGKAYKAHKYTDVV
RGQKSAKQHFDEFIKEWQIKDLLKPISKLEFILFYQDVSALIDREEQFDSLIKQTWEL


>TTHERM_00219350(gene)
TAAAGTTTGATTCATTAAATAATAAATCAGTTATCTAATTGGAACAACCAAACATATTCA
GATTAAAAATTATATTCAAAATTTTATAAATTATTACTATAAATAATAATTCAAGCAGAT
AAAAACAATTTTGTTAGATTATTTTATTCTTTCACAAGCTAGTTTTACAAAATGAATCAA
GGATAAGGAAGCATTCCATAAAAATATCGCCACTAAGTTCGTATAGGAAACTGGAGCGAA
GAGTGGGAATTAGAAAAAATAAGGTATTGATCATTTTTCATTTAAAAAAATCTATATTAG
ATAATAGATTAAATATTATGTTTAACATGAGCTGCTTCTTTAATTCATTTACATATAAAA
ATGGTTAGATTCAAAGATTATTTAGCTACATAAACTAAAACATCAATTGCATAATAAAAG
ATCGAAGCTGGTCATCAAAAAGTATACTTTAAATTTAATTAACATTAATAATTATTCTAT
TTGCTTAAATGATTAAAAAAAACATATTAATTATATTAGGCTTCTCTCACTTATTCAAGA
GATGGTTACATTCATTTTGGAGATAGAATTATGCTTTATAATGATAAGACAAGAGGTTAT
TTAGGTAAAATGTTTGCCATTTCTTTTGAAATTATTATTAATTTTATTGAAAACAATTTA
GAGTACATAAATTAAATGTAAAATTAAAAAAAATAGTTTGTGATATTTGGGAAAAATATA
ACTAAATAGATGAAAGCTATCCTGTGTCTACAACTGGAAAGACCTTCCCATGTGCACGCT
CTATTTTCTTAATACAACCGTAACTATAAGATTTATTTTAAATATTATCTGTTTCGTTAA
CCAATTCATTAATTTAACATTAGTTGCCCTGAAGATTACAATCCTAGATAAAACATCTTG
TGCTATGGATAGAAATTTAAGATTGTTGTCAATCCTAGAATGTTTAGAAAACCAGTAAAA
ATTTTATTTAATTTTTAGGTAAAGGATTAAATTTAATTTTAAAATGAACTAGCTCTACTT
ATCTAGCTAGCCTGCTGATCCTTAAAGAAGTAAAAAAAACTCAAGACAATAAGATTCATT
CCTTTCTTCCAAGGATAATTTTGATTCTGTTTGGGTTGTTGAGCATATTGACCCTTAAAT
TAGATTTGAAATGAATAAATAACCTGTTAGAGCAAATGATCCTATAATCTTAAAACACTT
CTAAACAAATTAGTACTTAGCAAGTGATGAGTAGTAAGTGAAGAACACTTATGGAATTGA
AAACGAAGTTTTTGCTCTTTAATATTAAACATATAACAAAACATAAAATTTAATTGCTGA
AAAGATGGGAAGAACTACAATTGATATTCCTATGAGAAACTAGCATTCTTAAAACACTTG
GTGTCTTGTTACAGCTGATGATCCAATCTTAGAATTTGATGAGAGTGTTCTTGATCGTAT
AGAAACTCCTAAAGACATAGTTTAAAAGTTACGCTATTAAATATCTGCAAGAGGATTCTT
CAGTTTAAGAGGTCTTGATTTTATTTTTAGAGATATGGACTAATAAAAAACAGGTTAACT
TGAATATGACGATTTCCGTTGGGGTTTAAGAAACTTTGGAATACAATCAACACCAGAAGT
AAGCAGGATAATTCTTTAAAAAATATTTCTTAGAAAAAAATTAGAAAATAGCTTTTTAGT
TCAAAGAAATAAACTGAAAATTGAATATTATTTTTTATAATAAATAGGAAGTTAAATTAT
TAATGGAAGCTTATGATAAAAATCTTAATGGATATGTTGATTATCAAGAATTTATTTCAT
CTCTGAGAGTAAAAAATAAATTTTATTTTAATTCTTTAATTAATATTTATTTGCAAAAAT
ATCATTTTAAAGGGAAGCTTATCTGACAGAAGAAGTGATTTAGTTTCAAAAGCTTTTGAA
AAAATATAGCAATAGTATGGAGTAGTAAATTTAGAAACTATTGGTAAGGCTTACAAAGCA
CACAAATACACAGATGTAATTAAAAAAGTTAGAAGACAAGCAATTTAAAAAAATTATTAA
CTTTTTCAATAAAAGGTTGTAAGAGGTCAAAAATCTGCAAAGTAACATTTCGATGAATTC
ATAAAGGAATGGTAGATAAAAGATTTATTGAAACCAATTTCAAAATTAGAATTTATCCTT
TTCTATCAAGTAAGATCAATTTTGAATTAAAAGATTAAACTTAAATATAAATAATAATAT
TTTAAAAAGGATGTCAGTGCACTCATTGATAGAGAAGAATAGTTTGATTCTTTAATTAAA
TAAACTTGGGAATTGTGA