Identifiers and Description

Gene Model Identifier

TTHERM_01513260

Standard Name

BBC49

Aliases

PreTt05727 | 435.m00012

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR03385 ) CoA-disulfide reductase
  • ( PF07625 ) Protein of unknown function (DUF1586)
  • ( PF00070 ) Pyridine nucleotide-disulphide oxidoreductase
  • ( PF07992 ) pyridine nucleotide-disulphide oxidoreductase
  • ( TIGR03169 ) pyridine nucleotide-disulfide oxidoreductase family protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01513260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18439.19.997093137033517e-262hypothetical protein (433 aa)
OxytrichaContig2997.0.g293.999284652801983e-113Pyridine nucleotide-disulphide
oxidoreductase
DictyBaseDDB_G02922505.99747839515332e-98sqrdl on chromosome: 6 positio
n 1300465 to 1301905
WormBaseWBGene000085383.0005855096961235e-80locus:sqrd-1 status:Confirme
d UniProt:C6KRP5 protein_i
d:CAZ65483.1
Stentor CoeruleusSteCoe_373002.0842828425817514e-52

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01513260(coding)
ATGCTCAATAGGATCTTCAAGTATCAATTTGCTACTGCTACTCACACTCCTTTATGTATT
ATTGGTGGTGGTACAGCTAGTTTAAACGTCACTGCCTAACTTAGCCACAGAAAAGGAATC
AATTTAAGCCATATTAGAGTTTTTGATCCCTCCAGATTCCACTACTACCAACCTTCATGG
ACCATGGTTGGTGGTGGTTTGTATGATGCAGAAAAATCATATAGAACTTAATAAAGCCTC
TTTAACAAGAAAATTAACTTCAACTTTAATGCTGTAACTAAGGTTATCCCAGAGTAAAAC
AAGTTCATCACTGACGATGGCAGAGAATGGACCTATGACCATCTCATTATTTCTACAGGA
ATAAAGGTCGATTTCAAAGGAATCAAAGGTTTAAAGGAAGCATTAGATGACCCTAACTGC
CCTGTTGGCTCTATTTATTGGAAAGACTATGCTACTAAATTCAATTAATTTGCTAAAGAA
TTTAAAGGAGGCAAGGCCGTCTTCACTGAACCTTAAATGCCTATTAAGTGTGGTGGAGCT
CCTTAAAAGGTTTTGTACTTGAATGAAGAGCGTTTCCGTAGAAATGGTGTGAGAAACTAA
ACTTCAATCGAATTCCATAAAACTATACCCGTAGTTTTTGGTGTTCCTAAGTATAGTGCC
AGCTTAGCTGAAATTATCAAACAAAAGAATATCGATCTCCATCTTAAGAGTAAATTAGTT
GAAGTTCGTGGTTAAGATAGAGTTGCAGTATTTGAAAACCAAGATAATAAAGTTCTCACT
GAAGTTAAATTCGATTTACTCCATGCCGTTCCTCCTTAGACTGCTCCTAAGTTTATTGCT
GAAAGTGGACTAGGTGATGCTAGTGGATTTGTAGATGTTGATAAGTAGACTTTATTGCAT
AAAAAATACAAAAATGTGTGGGCTATAGGTGATAGCTCTAATCTCCCTACTTCTAAAACT
GCAGCTGCTGTTATGAGCTAAACTCCTATACTTGTTGATAATCTTCTCCATATCTGGAAA
TAAAAAAATAGTGAAGCTAGTCTTCCTTAAAAATACGAAGGTTATACAAGTTGTCCTATT
TTTACTGGTGATAAGAAGCTTATCCTTGCTGAGTTCAAATACGACTCAGTAGTTGATGAA
ACCTTCTACAGACATCAAGATAAGCCTCACAGATTATTCTATCATTTAAAGAAAGATTTC
TTCCCTTTTGCTTACTGGAATTTGATGGCTAGAGGTATTTGGTATGGTCGTGAAGGTATC
CTTCCTCACTTTTTAAAAACTATAACAAACACTTTTTGA


>TTHERM_01513260(protein)
MLNRIFKYQFATATHTPLCIIGGGTASLNVTAQLSHRKGINLSHIRVFDPSRFHYYQPSW
TMVGGGLYDAEKSYRTQQSLFNKKINFNFNAVTKVIPEQNKFITDDGREWTYDHLIISTG
IKVDFKGIKGLKEALDDPNCPVGSIYWKDYATKFNQFAKEFKGGKAVFTEPQMPIKCGGA
PQKVLYLNEERFRRNGVRNQTSIEFHKTIPVVFGVPKYSASLAEIIKQKNIDLHLKSKLV
EVRGQDRVAVFENQDNKVLTEVKFDLLHAVPPQTAPKFIAESGLGDASGFVDVDKQTLLH
KKYKNVWAIGDSSNLPTSKTAAAVMSQTPILVDNLLHIWKQKNSEASLPQKYEGYTSCPI
FTGDKKLILAEFKYDSVVDETFYRHQDKPHRLFYHLKKDFFPFAYWNLMARGIWYGREGI
LPHFLKTITNTF


>TTHERM_01513260(gene)
ATGCTCAATAGGATCTTCAAGTATCAATTTGCTACTGCTACTCACACTCCTTTATGTATT
ATTGGTGGTGGTACAGCTAGTTTAAACGTCACTGCCTAACTTAGCCACAGAAAAGGAATC
AATTTAAGCCATATTAGAGTTTTTGATCCCTCCAGATTCCACTACTACCAACCTTCATGG
ACCATGGTTGGTGGTGGTTTGTATGATGCAGAAAAATCATATAGAACTTAATAAAGCCTC
TTTAACAAGAAAATTAACTTCAACTTTAATGCTGTAACTAAGGTTATCCCAGAGTAAAAC
AAGTTCATCACTGACGATGGCAGAGAATGGACCTATGACCATCTCATTATTTCTACAGGA
ATAAAGGTCGATTTCAAAGGAATCAAAGGTAATTCAATTTTATTCATAATTTTAAATAAA
AAACGAGAGAATAGAGTCCTGAATCATAAAAATTATTTAAGTAAAACTCAAGAAAAAGCA
TAATAGGGAGAAATATATCCCAAAATTATAATAAAAGTATTAAAAAAAGAAGAAGAATCA
AGAGAATAAGCATTATAATTTTGATTAGTGTCAATATATGACATAATATAAAATATATGA
ATAATTTATAAAATTAAATTTATGTTTTTGATTACAGAAACATCATTAAAACTAATAAAA
AATAAATTATCAAATATAGATATTAATATGTATTTTTATACAAAAAGGTTTAAAGGAAGC
ATTAGATGACCCTAACTGCCCTGTTGGCTCTATTTATTGGAAAGACTATGCTACTAAATT
CAATTAATTTGCTAAAGAATTTAAAGGAGGCAAGGCCGTCTTCACTGAACCTTAAATGCC
TATTAAGTGTGGTGGAGCTCCTTAAAAGGTTTTGTACTTGAATGAAGAGCGTTTCCGTAG
AAATGGTGTGAGAAACTAAACTTCAATCGAATTCCATAAAACTATACCCGTAGTTTTTGG
TGTTCCTAAGTATAGTGCCAGCTTAGCTGAAATTATCAAACAAAAGAATATCGATCTCCA
TCTTAAGAGTAAATTAGTTGAAGTTCGTGGTTAAGATAGAGTTGCAGTATTTGAAAACCA
AGATAATAAAGTTCTCACTGAAGTTAAATTCGATTTACTCCATGCCGTTCCTCCTTAGAC
TGCTCCTAAGTTTATTGCTGAAAGTGGACTAGGTGATGCTAGTGGATTTGTAGATGTTGA
TAAGTAGACTTTATTGCATAAAAAATACAAAAATGTGTGGGCTATAGGTGATAGCTCTAA
TCTCCCTACTTCTAAAACTGCAGCTGCTGTTATGAGCTAAACTCCTATACTTGTTGATAA
TCTTCTCCATATCTGGAAATAAAAAAATAGTGAAGCTAGTCTTCCTTAAAAATACGAAGG
TTATACAAGTTGTCCTATTTTTACTGGTGATAAGAAGCTTATCCTTGCTGAGTTCAAATA
CGACTCAGTAGTTGATGAAACCTTCTACAGACATCAAGATAAGCCTCACAGATTATTCTA
TCATTTAAAGAAAGATTTCTTCCCTTTTGCTTACTGGAATTTGATGGCTAGAGGTATTTG
GTATGGTCGTGAAGGTATCCTTCCTCACTTTTTAAAAACTATAACAAACACTTTTTGA