Identifiers and Description

Gene Model Identifier

TTHERM_00688340

Standard Name

BBC39

Aliases

PreTt23129 | 105.m00096 | 3737.m00009

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03304 ) Mlp lipoprotein family
  • ( PF06705 ) SF-assemblin/beta giardin

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00688340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16677.16.002643599093603e-161hypothetical protein (251 aa)
OxytrichaContig1313.1.g997.001220308967917e-48SF-assemblin/beta giardin
Stentor CoeruleusSteCoe_108575.242885663363464e-22

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00688340(coding)
ATGTCATTCAGAGTCTCTTCTCCCCACAACGAAAGAATAGCTAAAATTAGCGAAAAATTG
AGCCAAGTACAATCCAATGCTAATAATGATCGTTCTGCAAAATTAGATTAAGGCGAATAA
AGAATTAAATTGTTAGAAGATTCATACACTGAATTCGAAGAAAAGCTTGAAAAAAAAGTC
ACAACTATTAGAGAAACTATTTAAAAACTCTCCAAGCTTGTTTAAGAAGATAAGTTGAAC
AGAGAACATCATTTCGAGCAAAAACAAAAAGAAATTGCTTCTCTTGATCAAAAGCTTAGC
TCTGCCATCGAAAGTGAAATTGCATCAAGAAAAGAAGGTGAAAATAAAATTACTAGAGCC
ATAGATGAAAAGACAAGTGTTATTAGAGATGAAATTTCAAGAGAATCTAAAATCAGAAAT
GAAACTATTGAAGAAATCAACCGCAAGTTAGAAATTGAATTGCCCAAGCTCAGAGATGAA
GTTAATAACGAAAAAGTTCAAAGAGAGGAAATGGATTAAAATATTATGAAGAAGACCACT
GAAGAACTTGTAAAACTCACTAACATAATATAGTAAGAAAAGAAGGATAGAGAAGAAAGC
GAGTAATCTATATTTGATATGTTGAAAGAAGTAGTACACCGTGTAAAGACTGAAATCGAA
AATGAAAAGAAGAATAGAGAAATGACAGAAGAAACTCTTCTTGGTTTATTAGAAGACACT
TGCAACAAATTAAATGCTGCTGCCCTTGTTTGA


>TTHERM_00688340(protein)
MSFRVSSPHNERIAKISEKLSQVQSNANNDRSAKLDQGEQRIKLLEDSYTEFEEKLEKKV
TTIRETIQKLSKLVQEDKLNREHHFEQKQKEIASLDQKLSSAIESEIASRKEGENKITRA
IDEKTSVIRDEISRESKIRNETIEEINRKLEIELPKLRDEVNNEKVQREEMDQNIMKKTT
EELVKLTNIIQQEKKDREESEQSIFDMLKEVVHRVKTEIENEKKNREMTEETLLGLLEDT
CNKLNAAALV


>TTHERM_00688340(gene)
ATGTCATTCAGAGGTTAGATATTTTTTTTATCCAAAAGAATATTTTAGCTTTGAGCTTAC
AAATTTATAAAAACCTTTATCTTAAAATATTTTAACCATTAAATTAACAGTCTCTTCTCC
CCACAACGAAAGAATAGCTAAAATTAGCGAAAAATTGAGCCAAGTACAATCCAATGCTAA
TAATGATCGTTCTGCAAAATTAGATTAAGGCGAATAAAGAATTAAATTGTTAGAAGATTC
ATACACTGAATTCGAAGAAAAGCTTGAAAAAAAAGTCACAACTATTAGAGAAACTATTTA
AAAACTCTCCAAGCTTGTTTAAGAAGATAAGTTGAACAGAGAACATCATTTCGAGCAAAA
ACAAAAAGAAATTGCTTCTCTTGATCAAAAGCTTAGCTCTGCCATCGAAAGTGAAATTGC
AGTAAACTAAAAATTTAAATAATTTTAAATTAGAATTTTAGCATAAGATTAATAAAGCAA
CAACACATAATCAATAATTTTATAAAAATGGATTTCGATTATAATTCTGTTTGATTATAC
TTTTAGTGCAAAAATGATTAGCTATTCTAACATTTATTATTATGAATTAAATAAAGTCAA
GAAAAGAAGGTGAAAATAAAATTACTAGAGCCATAGATGAAAAGACAAGTGTTATTAGAG
ATGAAATTTCAAGAGAATCTAAAATCAGAAATGAAACTATTGAAGAAATCAACCGCAAGT
TAGAAGTAATCATTTATTTCCTTATTTTTTGCTTACTTTCTTATACTCCTTAGTTAGATA
GCCATTAAATTTATTGAAACAAAGATTGTTAATACAAACAAATAGTTCAAAGATTTAAAA
TAAAAATTTGATAATCGGAGATATCTTATAAACATACATATAATTTACTTAGAATTTTGA
TAGAAATATTTAAATATATTTTTTCAACTAAAGATTGAATTGCCCAAGCTCAGAGATGAA
GTTAATAACGAAAAAGTTCAAAGAGAGGAAATGGATTAAAATATTATGAAGAAGACCACT
GAAGAACTTGTAAAACTCACTAACATAATATAGTAAGAAAAGAAGGATAGAGAAGAAAGC
GAGTAATCTATATTTGATATGTTGAAAGAAGTAGTACACCGTGTAAAGACTGAAATCGAA
AATGAAAAGAAGAATAGGTAAATCTTACTAATTAAATAGCAAATAAATAATTTAATTATA
TTTCTAAATTAAAAGAGAAATGACAGAAGAAACTCTTCTTGGTTTATTAGAAGACACTTG
CAACAAATTAAATGCTGCTGCCCTTGTTTGA