Identifiers and Description

Gene Model Identifier

TTHERM_00267880

Standard Name

BBC37

Aliases

PreTt09823 | 24.m00254 | 3690.m00068

Description

EF hand family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00267880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06886.14.998065322133077e-171EF hand family protein (301 aa
)
OxytrichaContig18773.0.g478.997587713565275e-70EF-hand domain pair
WormBaseWBGene000068610.000019995566179747357locus:cal-5 status:Confirmed
UniProt:Q18136 protein_id
:CCD65556.1
DictyBaseDDB_G02870090.00010003404299092957mcfC on chromosome: 4 position
5197882 to 5199603

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00267880(coding)
ATGTCTCTCTACGGTGTTGGTTTAAATGTTTAAGTAGACAGAATAAAGACTGAGTTCCGC
TTATATGTCTCAAAATAAAAAGGAGGTTTGAATGTTAGAAACCTAAGAAGGATTTTTGAA
TAGCTTGATTATTAATAAAATGGTCAGCTTAATCTTGATGATTTTAAGGCAGGTCTTAAT
AAATTCGGATTCTTTTTGAAGAATGTTGATTATTAATGTCTTCTTAAATATTTTGACGTT
GAACAAAACGGAAACGTTAACTATTTGGCCTTTTTATCTTGCATTTCCTAAACCTTGAAC
CAAAGAAGAGCCAACTTCGTCCTTAAAGTATTTGACTCAATAGATTCTGAATAAAAAGGA
GCAGTGCACCCCTTCTCACTTGCTGAAAGACTTGAAGTTGTCAAAAATAAAGATTATTAA
ATTGGAAGCAAGACCAGAGAATAGCTTGTTGGTGAATATGTTGCTCAATTCCATAAAAAC
TAAGATGGGTTGATAACAAGAGATGAGTTTGTTTCTTACTATGAAGATTTAGGACTAGGA
ATTTCTTCTGACTAACATTTTATCGAAATTCTTTAGACTTAATGGGGCATAAAGGAAGAT
GATGACCTTGCGATTACTAAAGAAGAAGTAAAAGGAATAGTTAAAACTATCAGATAAAAG
TTAATCCAAAAAACTAAGGGAGCTAATGACGAATTCCTTCTCAGAAAGCTTTTCAAAGAA
TTTGATATTAGCAACAGTGGATTCCTTACTTTAGATGAGATGAATGCAATGTTGATTAAA
TTAGAAATCCCAATTCAAAAGAGATATCTTAATGCAGTATTCTCTTAATTAGATAGAAAT
CACTCTGGAGTCATCGAATTTGAAGAGTTTGTTTATTACATTGTCAACGACCCTTATCCA
TGA


>TTHERM_00267880(protein)
MSLYGVGLNVQVDRIKTEFRLYVSKQKGGLNVRNLRRIFEQLDYQQNGQLNLDDFKAGLN
KFGFFLKNVDYQCLLKYFDVEQNGNVNYLAFLSCISQTLNQRRANFVLKVFDSIDSEQKG
AVHPFSLAERLEVVKNKDYQIGSKTREQLVGEYVAQFHKNQDGLITRDEFVSYYEDLGLG
ISSDQHFIEILQTQWGIKEDDDLAITKEEVKGIVKTIRQKLIQKTKGANDEFLLRKLFKE
FDISNSGFLTLDEMNAMLIKLEIPIQKRYLNAVFSQLDRNHSGVIEFEEFVYYIVNDPYP


>TTHERM_00267880(gene)
ATGTCTCTCTACGGTGTTGGTTTAAATGTTTAAGTAGACAGAATAAAGACTGAGTTCCGC
TTATATGTCTCAAAATAAAAAGGAGGTTTGAATGTTAGAAACCTAAGAAGGATTTTTGAA
TAGCTTGATTATTAATAAAATGGTCAGCTTAATCTTGATGATTTTAAGGCAGGTCTTAAT
AAATTCGGATTCTTTTTGAAGAATGTTGATTATTAATGTCTTCTTAAATATTTTGACGTT
GAACAAAACGGAAACGTTAACTATTTGGCCTTTTTATCTTGCATTTCGTAAAAAAATTTG
TTTTAATTTTAATAATTGTTATCTTTTCATTCTTTGATTTATAGAGTGAAAAATAATCAA
ATTGCAATCAAATTTTGTAAAATTTTGAAAATATTGCTGATAATTCTTTTAAAAACAAAA
GCTAAACCTTGAACCAAAGAAGAGCCAACTTCGTCCTTAAAGTATTTGACTCAATAGATT
CTGAATAAAAAGGAGCAGTGCACCCCTTCTCACTTGGTATAATAAAATTAATAAAATTTG
GATTCTTACAAAAAGCAACTGAAAATCTAAATTGATTGAATAAATAAATAAATAGTTGTT
AACAAAAAAATATTAATAAATAAATAAATTTATTAAAATATCATCATTGATTTAATTAAT
TAGCAATTAAAATTCATTAGAAATATTAAAAATTTACATATAAAATAGCTGAAAGACTTG
AAGTTGTCAAAAATAAAGATTATTAAATTGGAAGCAAGACCAGAGAATAGCTTGTTGGTG
AATATGTTGCTCAATTCCATAAAAACTAAGATGGGTTGATAACAAGAGATGAGTTTGTTT
CTTACTATGAAGATTTAGGACTAGGAATTTCTTCTGACTAACATTTTATCGAAATTCTTT
AGACTTAATGGGGCATAAAGGAAGATGATGACCTTGCGATTACTAAAGAAGAAGTAAAAG
GAATAGTTAAAACTATCAGATAAAAGTTAATCCAAAAAACTAAGGGAGCTAATGACGAAT
TCCTTCTCAGAAAGCTTTTCAAAGAATTTGATATTAGCAACAGTGGATTCCTTACTTTAG
ATGAGATGAATGCAATGTTGATTAAATTAGAAATCCCAATTCAAAAGAGATATCTTAATG
CAGTATTCTCTTAATTAGATAGAAATCACTCTGGAGTCATCGAATTTGAAGAGTTTGTTT
ATTACATTGTCAACGACCCTTATCCATGA