Identifiers and Description

Gene Model Identifier

TTHERM_00161270

Standard Name

BBC31

Aliases

PreTt28519 | 13.m00478 | 3829.m01338

Description

conserved hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06294 ) Domain of Unknown Function (DUF1042)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00161270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05382.19.002943066426541e-124hypothetical protein (215 aa)
OxytrichaContig16290.0.g212.9997246065828143e-59Domain of Unknown Function (DU
F1042)
Stentor CoeruleusSteCoe_122793.221340285992516e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00161270(coding)
ATGGAAGAAGCTCCTCATTTAAACGAAGATTAATTGAATGAAATTTATAGTTGGGTAGAT
TCTATCCCACTCTCCCGCCCAAAGAAGAATATAGCAAGAGATTTTTCAGATGGAGTTCTA
ATGGCAGAAGTAGTAGCTCACTGCATCCCCAGATTAGTTGAATTACACAATTATTCAGCA
GCTAATTCAGTTAAACAAAAATATTACAATTGGGAAACTCTCAACAAGAAAGTATTTTCT
AAGCTTGGCTTGCTAGTTTGTAAAACTGATATAACAAATATCGTTGAATGCAAGCCAGAA
GTGATTGAAAGAGTATTAAAGCTTGTCAAGAATCACATAGAAGCTTTTAATAGCGATCCT
TAAAATTTTTCACCTGAAAAATCTCAAAAGTCTTTCAACCAAATAAAGCGTGGTGGTGCT
CTTATGGATAGAGGAAATAACAAGTAAAGATTTTAGAATTAGGATAACCAGTATTAGCAA
TCATAGTAAGATGAAATCATTTGGGAAAAGGATTAAACTATAAGCGAACTTAGAGAAACC
ATAGAGATTTTAGAGCTAAAGATGAAGAAATTAGAAGATTTAATAAAATTAAAAGATAAT
AAAATAGCAACTCTTTAAAATAGAATGGCTGAACATGGCCTATATTGA


>TTHERM_00161270(protein)
MEEAPHLNEDQLNEIYSWVDSIPLSRPKKNIARDFSDGVLMAEVVAHCIPRLVELHNYSA
ANSVKQKYYNWETLNKKVFSKLGLLVCKTDITNIVECKPEVIERVLKLVKNHIEAFNSDP
QNFSPEKSQKSFNQIKRGGALMDRGNNKQRFQNQDNQYQQSQQDEIIWEKDQTISELRET
IEILELKMKKLEDLIKLKDNKIATLQNRMAEHGLY


>TTHERM_00161270(gene)
ATGGAAGAAGCTCCTCATTTAAACGAAGATTAATTGAATGAAATTTATAGTTGGGTAGAT
TCTATCCCACTCTCCCGCCCAAAGAAGAATATAGCAAGAGATTTTTCAGATGGAGTTCTA
ATGGCAGAAGTAGTAGCTCACTGCATCCCCAGATTAGTTGAATTACACAATTATTCAGCA
GCTAATTCAGTTAAACAAAAATATTACAATTGGGAAACTCTCAACAGTAAGTTATTCGTT
AAGTTTTTATTATGGATAATCAATCATTAGCTTGCAAAGGCAGCTTGATTTACAAAAAAC
ACAATTGTTATTATATTTTAGGATATTTTAATTTCTACAGATAGTTGCTCAACCAATATC
AATTAATTTTCAGTGCAATTAATTAGCATGAGCTTCTTTTCTCAAATTAATTCAAAGATA
TTTTAGAAAGAAACTGAAAAATATTTTTAGCTAAACATGCATTTATATTAACTATTTGTC
TTTAACTATTAATTAGAGAAAGTATTTTCTAAGCTTGGCTTGCTAGTTTGTAAAACTGAT
ATAACAAATATCGTTGAATGCAAGCCAGAAGTGATTGAAAGAGTATTAAAGCTTGTCAAG
AATCACATAGAAGCTTTTAATAGCGATCCTTAAAATTTTTCACCTGAAAAATCTCAAAAG
TCTTTCAACCAAATAAAGCGTGGTGGTGCTCTTATGGATAGAGGAAATAACAAGTAAAGG
TAATTATTTAAATACTCATAGAAAATACATAAAAGTTTGTTTGTTCCTCAATAAATTTTT
ATTTATGTTCTAATAACTGCAATAAATATATTTCTAGCGACATAAATAATTTTTAATTTA
AAAATAGATTTTAGAATTAGGATAACCAGTATTAGCAATCATAGTAAGATGAAATCATTT
GGGAAAAGGATTAAACTATAAGCGAACTTAGAGAAACCATAGAGGTAAATAAATAAATAT
TTTGCAAGATATCCTAAACATCTAATAAAATAAATTGATAAAACCATCAAATCAAATCAA
ACTAAACTTCTCTCTAATCATTTCAATGAAAAATTATCAATGTTTATCAGTTTATTATAT
ATTAAAATTTAAATTCTTGCTTTAATTATTTAAATTCCTTGCTTATTAAAAAATAGATTT
TAGAGCTAAAGATGAAGAAATTAGAAGATTTAATAAAATTAAAAGATAATAAAATAGCAA
CTCTTTAAAATAGAATGGCTGAACATGGCCTATATTGA