Identifiers and Description

Gene Model Identifier

TTHERM_00388640

Standard Name

BBC30

Aliases

PreTt24859 | 41.m00266

Description

SPFH domain / Band 7 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 28.5%

TetraMine Data

TTHERM_00388640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04493.11.0000509032773212e-171SPFH domain/Band 7 family prot
ein (279 aa)
OxytrichaContig14352.0.g527.997481627602355e-72SPFH domain / Band 7 family
SGDYGR231C8.997587713565275e-70PHB2 Subunit of the prohibitin
complex (Phb1p-Phb2p), a 1.2
MDa ring-shaped inner mitochon
drial membrane chaperone that
stabilizes newly synthesized p
roteins; determinant of replic
ative life span; involved in m
itochondrial segregation
DictyBaseDDB_G02841179.001321650308988e-69phbB on chromosome: 4 position
1608856 to 1609984
WormBaseWBGene000040152.9987670792171964e-67locus:phb-2 Mitochondrial pr
ohibitin complex protein 2 s
tatus:Confirmed UniProt:P500
93 protein_id:CCD66149.1
Stentor CoeruleusSteCoe_93967.281290178321643e-33

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00388640(coding)
ATGGCTCAAAAAGTAGCTTCTGCTGTTTCTTTAGGTGTTGCCGGTGTTGCAGGACTTATC
ATTGCATAAAGTTGCATTTACACAGTTGAACCAGGTCATACTGCCTTAAAATTCTCTAGA
CTTACAGGCTTGAGTGATAAATAATATAACGAAGGATGGCATTTAAGAGTTCCTTACTTT
GAAAGACCCATCATTTTCAATACTTAAACACGTTATAAAACTTTCCCTGCTAACACTGCT
AATGCAGATATGTAAAGTGTTAACATTACAGTCAGAGTTCTTTTTGAACCTATCTAAGAT
AAACTTTCAGAATTATACAGATATGTTGGATAAGATTATGATAATAAAATTCTTCCTTCT
ATTATGAATGAAGTTATGAGAGCTGTTGTAGCCTAATACTCTGCAAGTTAATTGATGAGT
TAAAGAGATAAGATTTCATAGAAAATTTAAAAAATTCTTGAAGAAAGAGCTAGAGTTTTC
CATATTAACATTAAAAATATTGCTATTACTGAACTTTCTTTCTCTAAAGAATATTAAGAA
GCCACTGAAGCTAAGAAGATTGCATAATAAGAAGCTGAAAGAGCTAGATATTATGTAGAA
ATGGCTAAAGATATTAAGAAATCTATTATTATTAAAGCTCAAGCTTAAACTAAATCTATC
GAATTAGTTGGTCAAGCTGCTGCCAATGATGCATCTTATATTGATTTGAAGAGAATTGAA
TATGCTAAGGAAATAGCTTCAGTTTTAGCTGATTCTCGTAATCATATTATGTTAAATAGC
GATATCTTACAAATGGACGCTTCTCTTAAAACTCCAAAGAGAAATTGA


>TTHERM_00388640(protein)
MAQKVASAVSLGVAGVAGLIIAQSCIYTVEPGHTALKFSRLTGLSDKQYNEGWHLRVPYF
ERPIIFNTQTRYKTFPANTANADMQSVNITVRVLFEPIQDKLSELYRYVGQDYDNKILPS
IMNEVMRAVVAQYSASQLMSQRDKISQKIQKILEERARVFHINIKNIAITELSFSKEYQE
ATEAKKIAQQEAERARYYVEMAKDIKKSIIIKAQAQTKSIELVGQAAANDASYIDLKRIE
YAKEIASVLADSRNHIMLNSDILQMDASLKTPKRN


>TTHERM_00388640(gene)
ATGGCTCAAAAAGTAGCTTCTGCTGTTTCTTTAGGTGTTGCCGGTGTTGCAGGACTTATC
ATTGCATAAAGTTGCATTTACACAGGTATTTAATTGGAGTTATTACTACTATTACGAATT
ACTAAAAAATAATAATTGTTTGGTTGAATTGCAAATAAATTACTAAAATAAGATGAATAT
TTTTTATAAAAGATGAAAAAACTAACAAATATTATAAAATAAATAGTTGAACCAGGTCAT
ACTGCCTTAAAATTCTCTAGACTTACAGGCTTGAGTGATAAATAATATAACGAAGGATGG
CATTTAAGAGTTCCTTACTTTGAAAGACCCATCATTTTCAATACTTAAACACGTTATAAA
ACTTTCCCTGCTAACACTGCTAATGCAGGTATTTTAAAAAATTTTATAATTTTTAAATTA
AAAGAATTTAATTTAATTTTTATGGAATATTAAAAAATGTTTTATAAAAATTAAGATATG
TAAAGTGTTAACATTACAGTCAGAGTTCTTTTTGAACCTATCTAAGATAAACTTTCAGAA
TTATACAGGTAAATAATTAATGAATATTATTTAAACACAAAAGAACAATTATATACAACG
AAATTTGTTAAATTATATCCAAATAACATGAAGCTAATATTAAAGATTTTTAAAACGATT
TTTATTATACTAAATACTAACTCTATCTATTATAAGTAATAACTAAACTAATTAATTAAT
TAATTATAAATTTTAAAGATATGTTGGATAAGATTATGATAATAAAATTCTTCCTTCTAT
TATGAATGAAGTTATGAGAGCTGTTGTAGCCTAATACTCTGCAAGTTAATTGATGAGTTA
AAGAGATAAGATTTCATAGAAAATTTAAAAAATTCTTGAAGAAAGAGCTAGAGTTTTCCA
TATTAACATTAAAAATATTGCTATTACTGAACTTTCTTTCTCTAAAGAATATTAAGAAGC
CACTGAAGCTAAGAAGATTGCATAATAAGAAGCTGAAAGAGCTAGATATTATGTAGAAAT
GGCTAAAGATATTAAGAAATCTATTATTATTAAAGCTCAAGCTTAAACTAAATCTATCGA
ATTAGTTGGTCAAGCTGCTGCCAATGATGCATGTAATAAATATAATTGACTTTTAATTAA
TTATTTTGTTTGTTAAAAATATTTTTTTTACTAAATTAGCTTATATTGATTTGAAGAGAA
TTGAATATGCTAAGGAAATAGCTTCAGTTTTAGCTGATTCTCGTAATCATATTATGTTAA
ATAGCGATATCTTACAAATGGACGCTTCTCTTAAAACTCCAAAGAGAAATTGA