Identifiers and Description

Gene Model Identifier

TTHERM_00688560

Standard Name

BBC29 (Basal Body Component 29)

Aliases

PreTt23151 | 105.m00118 | 3737.m00031

Description

Kinetodesmal fiber protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00688560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16656.16.001748851346514e-171hypothetical protein (253 aa)
OxytrichaContig1313.1.g992.000214949834694e-50SF-assemblin/beta giardin
Stentor CoeruleusSteCoe_108576.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000387

Sequences

>TTHERM_00688560(coding)
ATGCAAAAAAGCGGTATCTACTCAAGTCCCTACGCTGAACGTTTCAATAAAATCAGTGAA
AAGCTTTCCTAAATTCCTCTTTCTTAAGAAGGATCTAGAGCAAACAGAATCGATAATTTT
GAATAGCGTGTCCGTTAACTTGATGAAAAGTTTAATACATCAATTGAATAATACAATAAG
AAAATTGCTGGATTAAAAGAAGAAGTATTCAAGCTTTAAAAGTTGGTTGAAGATAACTCA
AAGAGTTTCGAATTATAGCTTGAAACTCGTAATAAGGAAATTACCAACTTAGACAACAAA
CTTGCATAAAAATTAGAAAACGAAATAGCTAGCCGTCGTGATTCCGAATCAAAGTAAGTG
AGATACTTAGAAGAAAAGATCAACTTCCTCCGCGCTGATATTTCAACTGAAACTAAGATT
CGTTCAGAAATACTTAGCTCTCTTAATGCAACCTTAGAAGCTGATCTTCCCAAGCTATAT
GAAATAGTTAAATCTGAAGGAGTTGAAAGAGAAAGCTGTGACTCTATTACTCTTAAGAAG
GCTGCTGATGAAATTAAGAAAATCCATGACTTCCTCGCTACCTAAAAGAGAACTCGTGAA
GAAACTGAGTCAACCATTTTCGAAATGCTTAAGGAACTCGTAAATAGAATCAAATCAGAG
ATTGATGAGGAAAGAAAGGATCGTGAACAATCTCAAGAAACTTTAGTTAGTCTCCTTGAA
GATGCTGCTAATAAGCTATGTGCAACTGCTCAAGTTTGA


>TTHERM_00688560(protein)
MQKSGIYSSPYAERFNKISEKLSQIPLSQEGSRANRIDNFEQRVRQLDEKFNTSIEQYNK
KIAGLKEEVFKLQKLVEDNSKSFELQLETRNKEITNLDNKLAQKLENEIASRRDSESKQV
RYLEEKINFLRADISTETKIRSEILSSLNATLEADLPKLYEIVKSEGVERESCDSITLKK
AADEIKKIHDFLATQKRTREETESTIFEMLKELVNRIKSEIDEERKDREQSQETLVSLLE
DAANKLCATAQV


>TTHERM_00688560(gene)
ATGCAAAAAAGCGGTATCTACTCAAGTCCCTACGCTGAACGTTTCAATAAAATCAGTGAA
AAGCTTTCCTAAATTCCTCTTTCTTAAGAAGGATCTAGAGCAAACAGAATCGATAATTTT
GAATAGCGTGTCCGTTAACTTGATGAAAAGTTTAATACATCAATTGAATAATACAATAAG
AAAATTGCTGGATTAAAAGAAGAAGTATTCAAGCTTTAAAAGTTGGTTGAAGATAACTCA
AAGAGTTTCGAATTATAGCTTGAAACTCGTAATAAGGAAATTACCAACTTAGACAACAAA
CTTGCATAAAAATTAGAAAACGAAATAGCTAGCCGTCGTGATTCCGAATCAAAGTAAGTG
AGATACTTAGAAGAAAAGATCAACTTCCTCCGCGCTGATATTTCAACTGAAACTAAGATT
CGTTCAGAAATACTTAGCTCTCTTAATGCAACCTTAGAAGCTGATCTTCCCAAGCTATAT
GAAATAGTTAAATCTGAAGGAGTTGAAAGAGAAAGCTGTGACTCTATTACTCTTAAGAAG
GCTGCTGATGAAATTAAGAAAATCCATGACTTCCTCGCTACCTAAAAGAGAACTCGTGAA
GAAACTGAGTCAACCATTTTCGAAATGCTTAAGGAACTCGTAAATAGAATCAAATCAGAG
ATTGATGAGGAAAGAAAGGATCGTGAACAATCTCAAGAAACTTTAGTTAGTCTCCTTGAA
GATGCTGCTAATAAGCTATGTGCAACTGCTCAAGTTTGA