Identifiers and Description

Gene Model Identifier

TTHERM_01194830

Standard Name

BBC23

Aliases

PreTt07520 | 270.m00046

Description

AhpC/TSA family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.5%

TetraMine Data

TTHERM_01194830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21017.17.999687362287465e-134AhpC/TSA family protein (204 a
a)
OxytrichaContig14549.0.g117.999011707514803e-86AhpC/TSA family
WormBaseWBGene000064343.0005855096961235e-80locus:prdx-2 status:Confirme
d UniProt:Q8IG31 protein_i
d:CCD68767.1
DictyBaseDDB_G02748591.9999590304423412e-72prdx4 on chromosome: 2 positio
n 4213176 to 4214537
SGDYML028W5.001742359316081e-68TSA1 Thioredoxin peroxidase, a
cts as both a ribosome-associa
ted and free cytoplasmic antio
xidant; self-associates to for
m a high-molecular weight chap
erone complex under oxidative
stress; deletion results in mu
tator phenotype
Stentor CoeruleusSteCoe_21173.0144087850653746e-40

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01194830(coding)
ATGTCAAAGGCTTTCATTAATAAACCCGCTCCCGCTTTCACAACCACTGCTTGGGATGGT
AGCGTTAAAACTATCTCATTAGATTAATATCTTGGTAAGTGGGTCTTGTTGTTCTTCTAC
CCCTTCGATTTCACTTTTGTCTGCCCCACTGAAATCATCAGCTTTTCTGATGCCGCTGAA
ACCTTCAGAAAGATGAACTGCGAAGTCCTCGGTTGCTCTATTGACTCTCACTTCGTCCAT
GCTGAATGGTGCAAGAAGCCCAGAAAAGAAGGTGGTTTGGGTAACATGCAAATCCCCTTA
TTGGCTGATGTTTCCAAGCAAATCAGCTCTGACTACGGTGTCTTGATCACCGAAGGTGAT
GCCAAGGGTGCTGCTTACAGAGGTACTTTCATCATCGACCCTAAGGGTAACATTAGACAT
ATTTCCATCAATGACTTACCTGTTGGTAGAAACATTGATGAATACATCAGATTAGTCTAA
GCCTTCCAATTCGTTGAAGAACATGGTGAAGTCTGCCCTGCTAAGTGGAAACCTGGTGCT
AAATCTATGGTCCCTGATCACAACTCTTCTAAGCTCAAGGAATACTGGGAAAATGAACAT
GCCAAAAAGTGA


>TTHERM_01194830(protein)
MSKAFINKPAPAFTTTAWDGSVKTISLDQYLGKWVLLFFYPFDFTFVCPTEIISFSDAAE
TFRKMNCEVLGCSIDSHFVHAEWCKKPRKEGGLGNMQIPLLADVSKQISSDYGVLITEGD
AKGAAYRGTFIIDPKGNIRHISINDLPVGRNIDEYIRLVQAFQFVEEHGEVCPAKWKPGA
KSMVPDHNSSKLKEYWENEHAKK


>TTHERM_01194830(gene)
ATGTCAAAGGCTTTCATTAATAAACCCGCTCCCGCTTTCACAACCACTGCTTGGGATGGT
AGCGTTAAAACTATCTCATTAGATTAATATCTTGGTAAGTGGGTCTTGTTGTTCTTCTAC
CCCTTCGATTTCACTTTTGTCTGCCCCACTGAAATCATCAGCTTTTCTGATGCCGCTGAA
ACCTTCAGAAAGATGAACTGCGAAGTCCTCGGTTGCTCTATTGACTCTCACTTCGTCCAT
GCTGAATGGTGCAAGAAGCCCAGAAAAGAAGGTGGTTTGGGTAACATGCAAATCCCCTTA
TTGGCTGATGTTTCCAAGCAAATCAGCTCTGACTACGGTGTCTTGATCACCGAAGGTGAT
GCCAAGGGTGCTGCTTACAGAGGTACTTTCATCATCGACCCTAAGGGTAACATTAGACAT
ATTTCCATCAATGACTTACCTGTTGGTAGAAACATTGATGAATACATCAGATTAGTCTAA
GCCTTCCAATTCGTTGAAGAACATGGTGAAGTCTGCCCTGCTAAGTGGAAACCTGGTGCT
AAATCTATGGTCCCTGATCACAACTCTTCTAAGCTCAAGGAATACTGGGAAAATGAACAT
GCCAAAAAGTGA