Identifiers and Description

Gene Model Identifier

TTHERM_00529770

Standard Name

BBC20

Aliases

PreTt04646 | 67.m00161 | 3684.m00031

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00529770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13673.18.000711020821268e-112hypothetical protein (173 aa)
OxytrichaContig20161.0.g731.000159011384939e-43FOP N terminal dimerisation do
main
Stentor CoeruleusSteCoe_235575.74952226429356e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00529770(coding)
ATGGCTTCAGTTAACGAATTAAAAGATGTCCTTAAAGAGACTCTTGAAGAGAAAGGTGTT
CTTACTAAAATAAGAGCTAAAATTAGAGCAGAAATATTTAATACATTGAATGATCAAGGA
ACTGAAAAGGCTCCTGTTTCCTCAGAAAATATGATTATAAATGAATTAATTAGAGAATAT
ATGGAATTTAATAATTATAATCACGCACTGTCTGTATTTATTCCTGAAACTGGATAACCC
TAGTAGCCTCCATTTGATCGTAATTTTATAGCTAAAAAACTTAAAATCATCGAAGATAAA
AACACAAGAGATCTACCTCTTTTATATGGTATAGTGTATGGCGTTAAAAAAATGGTAACA
AAAGATTTGGTTTAAGAATCCTAAAATAATACAGTTTCATAAAAGCTTGGAAAAACTTAA
TTTGCAGATGATTTAAATGATAATGATACTTCAAATTTTTAAGGTTAACAATCTAAAGGT
GGAGATAATAAACCCCTCTATTAAAATATATTTAACTGA


>TTHERM_00529770(protein)
MASVNELKDVLKETLEEKGVLTKIRAKIRAEIFNTLNDQGTEKAPVSSENMIINELIREY
MEFNNYNHALSVFIPETGQPQQPPFDRNFIAKKLKIIEDKNTRDLPLLYGIVYGVKKMVT
KDLVQESQNNTVSQKLGKTQFADDLNDNDTSNFQGQQSKGGDNKPLYQNIFN


>TTHERM_00529770(gene)
ATGGCTTCAGTTAACGAATTAAAAGATGTCCTTAAAGAGACTCTTGAAGAGAAAGGTGTT
CTTACTAAAATAAGAGCTAAAATTAGAGCAGAAATATTTAATACATTGAATGATCAAGGA
ACTGAAAAGGCTCCTGTTTCCTCAGAAAATATGATTATAAATGAATTAATTAGAGAATAT
ATGGAATTTAATAATTATAATCACGCACTGTCTGTATTTATTCCTGAAACTGGATAACCC
TAGTAGCCTCCATTTGATCGTAATTTTATAGCTAAAAAACTTAAAATCATCGAAGATAAA
AACACAAGAGATCTACCTCTTTTATATGTAAAAATTTATACTAATGTTAATAAAAATATA
TTGATAATTGTTTTTGAAAATAAAGGGTATAGTGTATGGCGTTAAAAAAATGGTAACAAA
AGATTTGGTTTAAGAATCCTAAAATAATACAGTTTCATAAAAGCTTGGAAAAACTTAATT
TGCAGATGATTTAAATGATAATGATACTTCAAATTTTTAAGGTTAACAATCTAAAGGTGG
AGATAATAAACCCCTCTATTAAAATATATTTAACTGA