Identifiers and Description

Gene Model Identifier

TTHERM_00433830

Standard Name

BBC14

Aliases

PreTt26524 | 48.m00287 | 3831.m01623

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00433830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04219.14.997910161537908e-106hypothetical protein (171 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00433830(coding)
ATGGCTATCAGAAATTTCGTTTTCAAGATTAGCAACTAGATTTAAAACTTAGCTGCCAAG
AGAAGTTTAGCTTACTTGAACTAAATCGATTCTTAGTCTGTTCCTTCTCGTGCCACCATC
AACATGAAGGACTAAGTTACTCAAATGTAGAGAGAAATCGATAATATGGCTAATGTCATT
AGAGCTTAGATCCCTGATGAAGACAGAGCTGAATTTGAAATCCTTAAAAAGTACTACGTT
ACCGGTCAACACGACTCCTTAGTCGATCCCCAAGATGTTCTCCTTCAACTCGACAGAATC
CAAGTCCTCAAGAATCTTAAGATGATCGAATTAAACGAAGAAGCTTATGACCCCGAACTT
GTCAGACTTGAGAAGCTCAAGGCTAGAGTCTTACTTGAAGAAGAAGGTGCCCTTTTGGAA
TATGCTCATTTCATTTCAAAGAGACCTTACAACAAGCCTTATGAAAAATGGGGTGTTAGC
GAAGAACACGTCAAGCAATAAATTCTTGGTTGA


>TTHERM_00433830(protein)
MAIRNFVFKISNQIQNLAAKRSLAYLNQIDSQSVPSRATINMKDQVTQMQREIDNMANVI
RAQIPDEDRAEFEILKKYYVTGQHDSLVDPQDVLLQLDRIQVLKNLKMIELNEEAYDPEL
VRLEKLKARVLLEEEGALLEYAHFISKRPYNKPYEKWGVSEEHVKQQILG


>TTHERM_00433830(gene)
ATGGCTATCAGAAATTTCGTTTTCAAGATTAGCAACTAGATTTAAAAGTAAAACAGACTA
ATAAAGCTAAAATAGCAAATATGGTGACTGGGATAAGAGTATAGGGGCTTTAAATTTTAT
TTAATTGCAAAAGAGCCTTTATTTTACTTCCTTAGTTGCCATATTTTCTTACTAAAATTA
CTTTTATTTAATCATATTAAACTATTAAATACAATTATAAATAGCTTAGCTGCCAAGAGA
AGTTTAGCTTACTTGAACTAAATCGATTCTTAGTCTGTTCCTTCTCGTGCCACCATCAAC
ATGAAGGACTAAGTTACTCAGTAATTCATTTTACATCTAAATAGGATTTAAATTTATTCT
TTCCTCAATTGATTTATTCACTTATGTATGAGCACAAAGATCTAAGTTAGTTTGTTAGTT
AGTTAGCTATTGTATTATTTATTTATTTAGTATTGATTGATCAATCTATCTATCTATCTT
TCGATCGTAAAGGAAAATTGCATTTATTTTTATATGAAATTTGCAAGCATATCAAAAAAA
ATAGAATGGGCTTCATTCAAATAGTGCTTAGTAGTGATAAATATCTTCTGAAAATGCTAT
AAATAAAAAATAAGCAATAATATTAAGCAAAACAATACCAAAGATACAACCATAAATGCG
CATGTTTTAAAACCAAAAGCTTTAATTGCTCTTAATTTTAATCAATTGAAAAAAGTTATT
TACTCATTCAACCTTACTAACTCTATTTTATTCCAAAATTAGAATGTAGAGAGAAATCGA
TAATATGGCTAATGTCATTAGAGCTTAGATCCCTGATGAAGACAGAGCTGAATTTGAAAT
CCTTAAAAAGTACTACGTTACCGGTCAACACGACTCCTTAGTCGATCCCCAAGATGTTCT
CCTTCAACTCGACAGAATCCAAGTCCTCAAGAATCTTAAGTAAGAAATAGTTTAAACAAA
TACTAAAAAAAAGTGAATGAATAAATAAACAAAGAGAGAGAGAAATTAACAAATAAATAA
ACCATACATTTACAAAAATAACTATTGTTAAAATAAATGCCTACACAAAATATATTAACA
AAAAGTGATCTTAGATACTTGAATTAAGTATTTTTTTTCTTAAAAGAATCTTAAAATTAA
TTATTTTATTTGAGAATTAAAACTGATATTTTAAAACATTTTAAATTTTAATTTAATTAA
TGAAATAAATTTAAAAAATAAAATAAATTCCTAAAGTAATTATTAGTATCCTTGATTAAT
TAAATTGGTTAAATATGTTTACAAAAGATTTCATTATTAAAATATATTTATTTATTTATA
AAGAGAAGAAAATAAAATAATGAATTAATAATTAAATCTTCATCTTGCTAATCATTATCA
TTACTTAAATGCTTACAACCTTATTTTTAAAATAGGATGATCGAATTAAACGAAGAAGCT
TATGACCCCGAACTTGTCAGACTTGAGAAGCTCAAGGCTAGAGTCTTACTTGAAGAAGAA
GGGTAATTAATTTAATTTTGATTGATTAATTTAATGTTTGTTTTTTTACTTAAATAATTT
AAAAATTAATGTTAATTTTTATAATTTAATATAAAATAAGATGATACTGTTTTATTTAAA
ATAACATCATCACTCATCAATTACAAAAATTACTTAGTTTTTTATTTGTTTGTTTAAATC
AACTTAAAAGACTGATTTCTATATCTATTTGTTTAACTTCATATTTTTGATTTTAATTTT
ATTAAAAATAAACAGTGCCCTTTTGGAATATGCTCATTTCATTTCAAAGAGACCTTACAA
CAAGCCTTATGAAAAATGGGGTGTTAGCGAAGAACACGTCAAGCAATAAATTCTTGGTTG
A