Identifiers and Description

Gene Model Identifier

TTHERM_00406590

Standard Name

BBC118

Aliases

PreTt12807 | 43.m00325 | 3713.m00146

Description

EF hand family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00036 ) EF hand
  • ( TIGR02702 ) iron-sulfur cluster biosynthesis transcriptional regulator

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00406590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13939.19.997093137033517e-262EF hand family protein (499 aa
)
OxytrichaContig15181.0.g968.997867044529537e-135EF hand
Stentor CoeruleusSteCoe_359407.667648073722e-53
WormBaseWBGene000039340.00000006998394348458725locus:pat-10 status:Confirme
d UniProt:G5EF37 protein_i
d:CCD67549.1
SGDYOR257W0.0000029996948234116693CDC31 Calcium-binding componen
t of the spindle pole body (SP
B) half-bridge, required for S
PB duplication in mitosis and
meiosis II; homolog of mammali
an centrin; binds multiubiquit
inated proteins and is involve
d in proteasomal protein degra
dation
DictyBaseDDB_G02760770.000005998506718272351mlcR on chromosome: 2 position
6426413 to 6427552

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00406590(coding)
ATGGATTGGATTAATAGATTAGAGAATATTTAAAACAAGATAAAGTTCTAGTTACACGCA
AAGAAAATAGATGATTTGGAGTCATTATACAGATTGATGGCTGAGTTCGATTTAGATAAC
TCAGGCAGACTTGAAAAGGACGAGTTTTTGAAGTTACTCAGCAAATTAGGAGTATTTTTA
ACAACTTAGGAACTCCGTGCAGTTTATGACACATACGACACCAATAGAGACGAATAGATC
TCTTATGCTGAATTTGTTTAAATGATTAGAACTACTATTTCCGAAAAACGTTTAGCTGTT
GTCAAGCATGCCTTCTAATTCCTTGATAGAAGAGGCAATGGTAAGCTCGCTATCTAAGAT
TTAGTCTAATAATACAGATCTGAAGCTCATCCTAGAGTTAGAACTCGCCATAAAACTGCT
GAATAAGTTAAGGCTGAATTCGTTAATGCTATCAGCAAGAAGAGTTAAGATGGCTAAACT
ATCAATGAAAACGAGTTTTTGGAGTACTATGCTGATGTCAATGCTACTTTACCTAAAGAA
AAGGAAGAATACTTTATTGATATTATTTTAAGCACTTGGGGTATTACTTCTTCTGTTGAT
TATGTTTCTCCGGAAAGACTCAATGATTTGGAATTAATCTTATATGAAAAAATCAGACAA
AAAACTCTCCCTGGAGAAGATGAAGGCAGAACTGTTTATCGTGCTTTCAAATACTTTGAT
ATTGCTGAAAAGGGAGTCATCGACATTTCTTAATTCAAGGCAGCTTTAGAAAAGTTTGGA
TGCGTTTTCGATGATAAAGAAATCCATGCCCTTTTCAGTAAATTCGATGTCAACCGTTCT
GGAAAAATATGCTATGACGAATTCTGTGGAAACTTCGCTAGATTGGGAAGTGGAAACAAT
CCTAATGTTAACCCTGTCTTTAAGCTAGCTAGAGAAGTACCTTCTCCTATCATCAATAAA
TTAAATGCAGACCTTAAAAAGCAAGGACCTTTTGCATTCAGATCTCTCTCCAAAGCTTGT
TAGAAGGCTGATACTTTCTTGAATGGCTCTCTTTCCCATGATGAATTCAAATGGGTCATT
AAAGAAATTGGTTTCTCACTTACAAAAACCGAATTCGATAACTTATTTAAATTCTTTGAC
AAAAATTATGAAGGAAAAGTTATTTATTCTGTCTTCATTGACTTAGTAAGAGGACAATAA
TCTGAAATAATTACCTAATCTTTAAGCTAAGGTTATGATGCTTTAGCATCCAATAACGGT
GGAAAAGTTACTGTTGAATCAATAGTTTAAAGATATAATCCCCTTGCAATTTAAATTATA
TATCCTACAAGAAAAATTGCATAGGATCTCCAAAGAGAGTTTGTTGCTGAATGGGGTGGA
AATCTATAATAATAAGTTAATAAAAACGCTTTCGTAGAGTTCTTTAGCGATGTTAGAGCC
TTCTGTGATAGTGAAAGCAAATTCCATCAATATTTTTCTAATGCTTTCGGATTGTGA


>TTHERM_00406590(protein)
MDWINRLENIQNKIKFQLHAKKIDDLESLYRLMAEFDLDNSGRLEKDEFLKLLSKLGVFL
TTQELRAVYDTYDTNRDEQISYAEFVQMIRTTISEKRLAVVKHAFQFLDRRGNGKLAIQD
LVQQYRSEAHPRVRTRHKTAEQVKAEFVNAISKKSQDGQTINENEFLEYYADVNATLPKE
KEEYFIDIILSTWGITSSVDYVSPERLNDLELILYEKIRQKTLPGEDEGRTVYRAFKYFD
IAEKGVIDISQFKAALEKFGCVFDDKEIHALFSKFDVNRSGKICYDEFCGNFARLGSGNN
PNVNPVFKLAREVPSPIINKLNADLKKQGPFAFRSLSKACQKADTFLNGSLSHDEFKWVI
KEIGFSLTKTEFDNLFKFFDKNYEGKVIYSVFIDLVRGQQSEIITQSLSQGYDALASNNG
GKVTVESIVQRYNPLAIQIIYPTRKIAQDLQREFVAEWGGNLQQQVNKNAFVEFFSDVRA
FCDSESKFHQYFSNAFGL


>TTHERM_00406590(gene)
ATGGATTGGATTAATAGATTAGAGAATATTTAAAACAAGATAAAGTTCTAGTTACACGCA
AAGAAAATAGATGATTTGGAGTCATTATACAGATTGATGGCTGAGTTCGATTTAGATAAC
TCAGGCAGACTTGAAAAGGACGAGTTTTTGAAGTTACTCAGCAAATTAGGAGTATTTTTA
ACAACTTAGGAACTCCGTGCAGTTTATGACACATACGACACCAATAGAGACGAATAGATC
TCTTATGCTGAATTTGTTTAAATGATTAGAACTACTATTTCCGAAAAACGTTTAGCTGTT
GTCAAGCATGCCTTCTAATTCCTTGATAGAAGGTTTTATTTTATTTGCATATTTAACTTA
TAATTTATTCATCAATTGACTATTTTAGTTAAGCAATCCTAATTCTATTTATATTTATCA
TAATGATATTTTATTCAAGAGCATTACAGAATTAACAACTTTAATCAAATGTGATTTTAT
TTTGTTAAAATTTTATTTTATTAATATTTTAGAGGCAATGGTAAGCTCGCTATCTAAGAT
TTAGTCTAATAATACAGATCTGAAGCTCATCCTAGAGTTAGAACTCGCCATAAAACTGCT
GAATAAGTTAAGGCTGAATTCGTTAATGCTATCAGCAAGAAGAGTTAAGATGGTAATTTA
TTGCATTGCTAAACGATTATTGAATTTGAACCAAATTTAAAATATGTTTGTTTAGTTGAT
AATAAATCTCGATAAAAGAAAAGTTGATTTTTGTTAATAAAATAAATAAAAATAAGAAAA
AAGATATAGATGATTGATTATGAAACTTACTTATTCAATTAAAATCCAAACATAAATAAC
TAATTCTAATATATCAATTTAATTATTTAAATATTTATTATTTTATTCAATCTAGGCTAA
ACTATCAATGAAAACGAGTTTTTGGAGTACTATGCTGATGTCAATGCTACTTTACCTAAA
GAAAAGGAAGAATACTTTATTGATATTATTTTAAGCACTTGGGGTATTACTTCTTCTGTT
GATTATGTTTCTCCGGAAAGACTCAATGATTTGGAATTAATCTTATATGAAAAAATCAGA
CAAAAAACTCTCCCTGGAGAAGATGAAGGCAGAACTGTTTATCGTGCTTTCAAATACTTT
GATATTGCTGAAAAGGGAGTCATCGACATTTCTTAATTCAAGGCAGCTTTAGAAAAGTTT
GGATGCGTTTTCGATGATAAAGAAATCCATGCCCTTTTCAGTAAATTCGATGTCAACCGT
TCTGGAAAAATGTAAAAAAATAAATAGCAATCAAATAAATAAGCTTTTTAAATTTTATAC
ATTGTTTATTTTTACTGACTTAAATTAACAATTAAATAAAATTAATATATAGATGCTATG
ACGAATTCTGTGGAAACTTCGCTAGATTGGGAAGTGGAAACAATCCTAATGTTAACCCTG
TCTTTAAGCTAGCTAGAGAAGTACCTTCTCCTATCATCAATAAATTAAATGCAGACCTTA
AAAAGCAAGGACCTTTTGCATTCAGATCTCTCTCCAAAGCTTGTTAGAAGGCTGATACTT
TCTTGAATGGCTCTCTTTCCCATGATGAATTCAAATGGGTCATTAAAGAAATTGGTTTCT
CACTTACAAAAACCGAATTCGATAACTTATTTAAATTCTTTGACAAAAATTATGAAGGAA
AAGTTATTTATTCTGTCTTCATTGACTTAGTAAGAGGTAATTATTATTTAAAAAAGAATA
AATAGGATAAAAATATTATTTTATTAATAAATATTAGGACAATAATCTGAAATAATTACC
TAATCTTTAAGCTAAGGTTATGATGCTTTAGCATCCAATAACGGTGGAAAAGTTACTGTT
GAATCAATAGTTTAAAGATATAATCCCCTTGCAATTTAAATTATATATCCTACAAGAAAA
ATTGCATAGGATCTCCAAAGAGAGTTTGTTGCTGAATGGGGTGGAAATCTATAATAATAA
GTAAATATTAAATATATCTTAAATTTTTTTAAAGCATTCTTTTTTTTAGGTTAATAAAAA
CGCTTTCGTAGAGTTCTTTAGCGATGTTAGAGCCTTCTGTGATAGTGAAAGCAAATTCCA
TCAATATTTTTCTAATGCTTTCGGATTGTGA