Identifiers and Description

Gene Model Identifier

TTHERM_00723590

Standard Name

Anqa11

Aliases

PreTt18119 | 116.m00144 | 3671.m00068

Description

Tesmin/TSO1-like CXC domain containing protein. Homolog of Lin54. Tetrahymena contains at least 14 Lin54-like genes (Anqa1-14) (Nabeel-Shah et al. 2021).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05033 ) Pre-SET motif
  • ( PF07974 ) EGF-like domain
  • ( PF03638 ) Tesmin/TSO1-like CXC domain
  • ( PF08729 ) Histone promoter control 2 (HPC2)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00723590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14832.19.997093137033517e-262tesmin/TSO1-like CXC domain-co
ntaining protein (740 aa)
OxytrichaContig21081.0.g241.9996410647472548e-29Tesmin/TSO1-like CXC domain
WormBaseWBGene000030377.998167219297731e-26locus:lin-54 Protein lin-54
status:Partially_confirmed
UniProt:Q95QD7 protein_id:C
AB05229.1
DictyBaseDDB_G02815197.997402223525235e-19lin54 on chromosome: 3 positio
n 4464773 to 4467683
Stentor CoeruleusSteCoe_228650.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_00723590(coding)
ATGAGCAACTTGAATAACTAGTACAGTGGAACCAATAACGCAAACTCCTATAACTACAAT
GTCTAAAATAAATTAGAGTCTTATAATAATATAGATAGCTTGATTGACTAAACTCCAAAG
AAGATATATAACTAATTCTCCTTAGGAATCAACTCAAGCCACCTCGTCAACAACGATAAA
GAAAACAGCTTTATTAAAGCCAACCACGATAACTATAACGATATGAACTACATGGACCAT
TACTAAAACAACTACCAGATTCCTAGTAATTATGGATATAACAATAACCACCATAATAGC
ATTAATCCTCAAAATTCGCATCTTGGTTAGCATTAAATGGATCACTATAATAATTATCAA
TATACTAGCTATGGATTCTACTATCCTCAGCAACCATACTATGGATATGACTATGTTAAC
GGTCACAATTATCCTCACTATCTAGATCCCTAAGGATATAACTAATCTTATAATAACTAC
TACTATAATAAGACCCCAAACACAGGACCAAAGATCCAATAGAATATCATCTTATAGAAG
TCAGAAAACAAATTGACAGGATAAGCTAATTAATAGGCTGTTGATGAGTTTGGCAACAAA
AAAGATGATTTTTAAGTTAGAAATCTATTTTAATAAGTTGTTATATCTGAATTTTAACCT
AACGAAAACGAATCTTAACAAATTACTTCAAACTAAGGTAAGTAGAATTTAAATTCTACT
AACAGCTGCAGTAGCGTGATTTAATTATAAAAAGGAAAGAGCAGTAAGAGTAAATCAAGC
ATGGAATAGGAGTCTGAATAGCAATAGCCTGAAGAATCAGCTAAAAAAAGTAAAATCACT
CCTTCCAAGCGTATTTCTAAAAAGAAACCAAAAAGCACCAAATAAACACCAACAAATTAA
TGCTCCAGCATTTAAGATAGTGAAGAAACTTTTAGCTATAAAAATTCTTTACTATAATCT
TAATTTGCAAATGCCAATATAGCTTTCAATAAAGCCCTTAATTCAGAATAATCTTCTGAT
AATATGATTTTAGAAGAGGAAGAAAACATTACAAAATAAGAAAAAGATAGCCAAAAATTA
GTCCGTCGTGATTCTTAAAACACAGTTAATAGAAAGGCTCCTCGTATTAGTAATGCTTCT
TCAATGATATCAAGCACAACAACAAAAATAGTAGACGAAAACAATAACCTAAATTAACTC
AACATTCATTAATAAATCAGCTAAGATCAAATTAATTACAATTATGGAACTTTTACTAAG
AGCAATAAATTGCAAGCTGAAAAATAAAAAAATGAAGAAGATCATTATGATGATAATTAA
CTAGAAATTGATGATTCTGATGACGAGGACAGAAATAACATGAATAATAATCACTAATTG
TCTCAATAAAAAAATAGAACATAACTATCAATCAGCAAATCACAACAATAATAACAAGAA
GTAGACTATGATCAAACTTCTAGTAAAAGTGACTCCGAAAAATCCCCAACTGAAGCTAAA
CCTTGTAATTGTAGAAACAGCAAATGCCTTAAGAGGTACTGTGACTGCTTTGCAGCTGGT
CTTTACTGTCAAGCTGAGTGCAAGTGTGAAGAATGCCATAATAAACCTGAATATGAAGAT
GAACGTCAAAAGGCTATTCAAAAAAAGAAGAAACGTATTAAAGATGCTTTTTTACCAGTA
ATCTAAAATAATTCACATATCAAAGGTTGTCACTGCAAAAATTCTCACTGCCAAAAAAAA
TATTGTGTCTGCCATTAAAACGGTGTCCTTTGTAGTAGTCTTTGCTAATGTGTTGAATGT
GAGAATAAGATTGAAAGTATGAAAAAAGAATAAAGCAGCATTTAAAATTATTAAGTATAA
CCTCCTGCATCATATCTGCAATCACCATATAATAACAATACACTTCAAATTTCTCCTATT
GCAATGCAGTAATAAATGGTAAAAGATAGCAGCCAAGTAATTAATAATAATTAATTTGCT
TAGTAGCACTTACAATCACCATACAATAATAATTCACTACAAAAAGATAATATAGATGTT
GAATTCCCTTCAACAATCAAAAAAGACTCAATAGGTAGTGTAAGTAAACCATATGAGGAG
GATTTTAGCACCCATAAAAAACCAACTAAACGCAAAGCGTTAAAGTTTAATGAAAAGTAA
AAAGCTCTATCCTCAATCTTTAACGAGATTTCTCCGGCTGATAACAAATACTTAGTTAAT
AAATCTTGA


>TTHERM_00723590(protein)
MSNLNNQYSGTNNANSYNYNVQNKLESYNNIDSLIDQTPKKIYNQFSLGINSSHLVNNDK
ENSFIKANHDNYNDMNYMDHYQNNYQIPSNYGYNNNHHNSINPQNSHLGQHQMDHYNNYQ
YTSYGFYYPQQPYYGYDYVNGHNYPHYLDPQGYNQSYNNYYYNKTPNTGPKIQQNIILQK
SENKLTGQANQQAVDEFGNKKDDFQVRNLFQQVVISEFQPNENESQQITSNQGKQNLNST
NSCSSVIQLQKGKSSKSKSSMEQESEQQQPEESAKKSKITPSKRISKKKPKSTKQTPTNQ
CSSIQDSEETFSYKNSLLQSQFANANIAFNKALNSEQSSDNMILEEEENITKQEKDSQKL
VRRDSQNTVNRKAPRISNASSMISSTTTKIVDENNNLNQLNIHQQISQDQINYNYGTFTK
SNKLQAEKQKNEEDHYDDNQLEIDDSDDEDRNNMNNNHQLSQQKNRTQLSISKSQQQQQE
VDYDQTSSKSDSEKSPTEAKPCNCRNSKCLKRYCDCFAAGLYCQAECKCEECHNKPEYED
ERQKAIQKKKKRIKDAFLPVIQNNSHIKGCHCKNSHCQKKYCVCHQNGVLCSSLCQCVEC
ENKIESMKKEQSSIQNYQVQPPASYLQSPYNNNTLQISPIAMQQQMVKDSSQVINNNQFA
QQHLQSPYNNNSLQKDNIDVEFPSTIKKDSIGSVSKPYEEDFSTHKKPTKRKALKFNEKQ
KALSSIFNEISPADNKYLVNKS


>TTHERM_00723590(gene)
ATGAGCAACTTGAATAACTAGTACAGTGGAACCAATAACGCAAACTCCTATAACTACAAT
GTCTAAAATAAATTAGAGTCTTATAATAATATAGATAGCTTGATTGACTAAACTCCAAAG
AAGATATATAACTAATTCTCCTTAGGAATCAACTCAAGCCACCTCGTCAACAACGATAAA
GAAAACAGCTTTATTAAAGCCAACCACGATAACTAGTAAATTTCTATTTTTAAATTAGTT
AACTCAGTTGTTAATGCAGCAAGCAATAAAACTTTTTAAGAAAGAGATCATATTTTTTAT
TATACTTCTCCTTTCAATTTAAAAATAACACCCCCTCTTTGTTTTAATTAACAATTTAGG
CTATATAATATACAAAGGCCTTTATTGTTTTATTAAAATTTAAAAAATGTGTGTTAATAA
AGTTTAATTTTTAATTATAATTAGTAACGATATGAACTACATGGACCATTACTAAAACAA
CTACCAGATTCCTAGTAATTATGGATATAACAATAACCACCATAATAGCATTAATCCTCA
AAATTCGCATCTTGGTTAGCATTAAATGGATCACTATAATAATTATCAATATACTAGCTA
TGGATTCTACTATCCTCAGCAACCATACTATGGATATGACTATGTTAACGGTCACAATTA
TCCTCACTATCTAGATCCCTAAGGATATAACTAATCTTATAATAACTACTACTATAATAA
GACCCCAAACACAGGACCAAAGATCCAATAGAATATCATCTTATAGAAGTCAGAAAACAA
GTAAATAGGAGTTTTCTTGAATTTTGTTTTTGATTCTCCTTTGATTTTTAATTAAAAATG
ATAGTGTTTAACGTATATATATTTGGAAATGAGATAATACTGAATCGTTTTCCTTCTTAA
ATTTAAAAATTAACAAGCGAAATTGAAGATTTAACTAAAAAAAATGAATATAATTAAAGC
ATATTAATTAAGGTGGGGAGAATTGAATTTATTTGCCATCATTTATATAATTTTAGAGAA
TATTTAATATATTAAATACAATGATAGATAAATAGTTAGATAGATAGATCCATCAATACA
TACATATATAAAAAGATTTTTCAATTAGTTTTCTTGAAAATCCTACCTAATTAATCTTCA
AATTATTTAAAAAACAATCTAATACATAAAAAAATTAAATAGTCATTATTTAATTTCCCA
AATATCTCAAATAAAACATAATTCCTACATTAATAATAACACAAAAGCAAACATATGATC
GATTAGATATATTGATATTTTAAATTAAGCAAATTAGTTAATTATTTATTTATTGCTGAA
TTAATTAATCAATTCACAAAATAATTAATTAATGAATGAGTTTTCCATATTTATTTTTCA
AATTGTGAATATTAATTTTCAATTATTCCCACTTTACTAATTTAAATCCATTTTCAATCA
TTTAATTAATAATAAGACTTTGAAATTTTAAAATAATCTAATTTATTTTTTAATTGTTAT
AGATTGACAGGATAAGCTAATTAATAGGCTGTTGATGAGTTTGGCAACAAAAAAGATGAT
TTTTAAGTTAGAAATCTATTTTAATAAGTTGTTATATCTGAATTTTAACCTAACGAAAAC
GAATCTTAACAAATTACTTCAAACTAAGGTAAGTAGAATTTAAATTCTACTAACAGCTGC
AGTAGCGTGATTTAATTATAAAAAGGAAAGAGCAGTAAGAGTAAATCAAGCATGGAATAG
GAGTCTGAATAGCAATAGCCTGAAGAATCAGCTAAAAAAAGTAAAATCACTCCTTCCAAG
CGTATTTCTAAAAAGAAACCAAAAAGCACCAAATAAACACCAACAAATTAATGCTCCAGC
ATTTAAGATAGTGAAGAAACTTTTAGCTATAAAAATTCTTTACTATAATCTTAATTTGCA
AATGCCAATATAGCTTTCAATAAAGCCCTTAATTCAGAATAATCTTCTGATAATATGATT
TTAGAAGAGGAAGAAAACATTACAAAATAAGAAAAAGATAGCCAAAAATTAGTCCGTCGT
GATTCTTAAAACACAGTTAATAGAAAGGCTCCTCGTATTAGTAATGCTTCTTCAATGATA
TCAAGCACAACAACAAAAATAGTAGACGAAAACAATAACCTAAATTAACTCAACATTCAT
TAATAAATCAGCTAAGATCAAATTAATTACAATTATGGAACTTTTACTAAGAGCAATAAA
TTGCAAGCTGAAAAATAAAAAAATGAAGAAGATCATTATGATGATAATTAACTAGAAATT
GATGATTCTGATGACGAGGACAGAAATAACATGAATAATAATCACTAATTGTCTCAATAA
AAAAATAGAACATAACTATCAATCAGCAAATCACAACAATAATAACAAGAAGTAGACTAT
GATCAAACTTCTAGTAAAAGTGACTCCGAAAAATCCCCAACTGAAGCTAAACCTTGTAAT
TGTAGAAACAGCAAATGCCTTAAGAGGTACTGTGACTGCTTTGCAGCTGGTCTTTACTGT
CAAGCTGAGTGCAAGTGTGAAGAATGCCATAATAAACCTGAATATGAAGATGAACGTCAA
AAGGCTATTCAAAAAAAGAAGAAACGTATTAAAGATGCTTTTTTACCAGTAATCTAAAAT
AATTCACATATCAAAGGTTGTCACTGCAAAAATTCTCACTGCCAAAAAAAATATTGTGTC
TGCCATTAAAACGGTGTCCTTTGTAGTAGTCTTTGCTAATGTGTTGAATGTGAGAATAAG
ATTGAAAGTATGAAAAAAGAATAAAGCAGCATTTAAAATTATTAAGTATAACCTCCTGCA
TCATATCTGCAATCACCATATAATAACAATACACTTCAAATTTCTCCTATTGCAATGCAG
TAATAAATGGTAAAAGATAGCAGCCAAGTAATTAATAATAATTAATTTGCTTAGTAGCAC
TTACAATCACCATACAATAATAATTCACTACAAAAAGATAATATAGATGTTGAATTCCCT
TCAACAATCAAAAAAGACTCAATAGGTAGTGTAAGTAAACCATATGAGGAGGATTTTAGC
ACCCATAAAAAACCAACTAAACGCAAAGCGTTAAAGTTTAATGAAAAGTAAAAAGCTCTA
TCCTCAATCTTTAACGAGATTTCTCCGGCTGATAACAAATACTTAGTTAATAAATCTTGA