Identifiers and Description

Gene Model Identifier

TTHERM_01205350

Standard Name

AXE2 (Ankyrin/histone H3 methyl transferase and EXosome 3-5 exoribonuclease 2)

Aliases

PreTt02725 | 273.m00030

Description

3'-5' exonuclease family protein; identified by homology with AXE1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_01205350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20551.19.997093137033517e-2623-5 exonuclease (1106 aa)
OxytrichaContig6366.0.g391.0004249259458435e-52Ankyrin repeats (3 copies)
SGDYOR001W6.996829646809514e-23RRP6 Nuclear exosome exonuclea
se component; has 3-5 exonucle
ase activity; involved in RNA
processing, maturation, survei
llance, degradation, tethering
, and export; has similarity t
o E. coli RNase D and to human
PM-Sc1 100 (EXOSC10); mutant
displays reduced transcription
elongation in the G-less-base
d run-on (GLRO) assay
DictyBaseDDB_G02715722.0002795641672355e-21exosc10 on chromosome: 2 posit
ion 601251 to 605014
Stentor CoeruleusSteCoe_363991.0530617357553812e-20
WormBaseWBGene000007968.002082816694397e-20locus:crn-3 status:Confirmed
UniProt:G5EBX6 protein_id
:CAA90108.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01205350(coding)
ATGGATTAAAGTATTAACTAGTAAAACTGGGAATCTCTTCTTGTTTAAGAGCTTTTCAAC
AATGAAATCCTTGATTTTATAGATAATGGATTGAATACAAAACCTTAATAGCTTCTTTAC
CTACTTTTCAAGTTAATGTAGGGTTTAAAACTAAATAAATAACATCAAAATAGTAACTCA
TCAGAATCTAATTCTGGTTTCAAATTATTACATGTAGAAGATGAAAATGATGATTAAAAG
CTAGAATATTTTTTGAAAAATACAATAACTACTTATGATTAGAATATTTAAACTATTGTA
AATTGCTAAGAATTAGTTAAAGCAAAAGAGGAATAATATAAATATTTAGTTAGATTAGAT
GATTAAATAAAATAAAATTGTTTGAAGCTTGAATTTAGCTAACAGAGTTAGCTATATGAT
TTTCATTAATAATGTGTGAATGGCTAATGGAAAAATTACAATCTTATTTCATTTTATCTA
TTTATCTCTCTGGGAAAAAGTAAGATATGGCCCAGACTATTCAAAGATATAAAATCTGGT
AAAAAAGTTGAGCGTCAATGGCAAATACATTAATTTTTCGATTAATTTAGAAATGACTTT
AGTAGCATTGTTAAATAAGGCTTTAATTCATCTGTCATATCAAAGAAGCATCAAAAGGAA
ATTGACAAACAAACAATCATTCAAAAAAGCAATAACTCCTTTATATAAGCTGTTAGGGAT
AATCAATTTGAAAAAGTCTAGTAAATGCTAGTAGATGGTACAAACATAGAAGCAATTGAT
ACAGTAGAATAATTTACAGCAGCACATATTGCTTGTGATGTGGGTAATATGGAAATGATA
AGATTACTTGATTCTTACAATTGTAATTGGGAAGCCCTAGACCATGAATAAATGACACCG
TTATATTATGCTATAAGAGGAGAAAATTTACCTACTGTCAAATTTTTAGTTGAAGAAAAA
AAGGTTAATATAGAACATAAAGAATTCATGCATAGAACTCCTTTTTACTGGGCTTGCTGC
CTAGGAAACCTTAGGATCATAAGATTTTTAACAGAAGCAGGAGCAGACATCAATGCAAAG
ACTAAACTAATGAGAACAGCACTTAATAAAGCTTGCTTTCTTGGAAGAGCAGATGTAGTT
TCCTACCTCTTATCTCAGCCTTAAATAGATTTTGAATGGGGAGATACTAAAGGAAGAAAT
CCACTTCATAACGCTATTTTTGGTCCTCGAGGTGGCAGGGAAGGAAAAAAAGTGGGAACT
TTTGGAAAGGATTGCCCTGAAGCTGCTCTTCTACTTTTAGAGAAAGGGGTAAATGTTGAT
GCTGAAGATGTTGATTAATCTACTCCTTTACATATAGCCTGTAGCTCTGAAGCATTGGAA
AGTATTCCTCTTTTAATTGCATATGGCGCAGATGTAAATAAACAAAATAAGTTTGGTGAT
ACAGCCTTGCATTTTGCTTCTCGTTTCGGACATATTAAAACAGTTATTATGCTCATAGAA
TAGTTTAATGCTCTAGTTTTAGAAGACTGTAAAGGATTTACAGGATTAGACAACGCTCTT
ATTGGTAATCATCTTGACATTTATACATATTTAATTGAAAAAATAGCGAAAGAATTCATT
TAAACGCCAGATTAAAAATATCGACATCTTAAGAATTTAATAAAGTAGCATGAGAATAAA
ACTCAAAAACTGTATCTTTAATTATTCCTAAATAATGTTGTAACTATTGATGATTATTAA
TACTTTTTTTCAAATGAAATTATTGAAATGCTTCCCTTGCTTAGGGATGTTGATATGTTT
GATATGCTTTCTTAAAAATTCAAACCATTTTTTGTTGAAGAAGATTAAATTATAAATTTG
CTGCTGATTGTAATTAAATCAAGGAAAATTGAGTTTTTTAACAAATTATTTGAAAGTTTT
ATAGATGTCTTTTAGAAATTTGAATTTAATAATGTAAATGAAATTTTACACAACATCCTA
GAGTATAATGACAGAGAAATAGTTTAAATAGCATTTACTTTAAACTTAAATATCTTTGAT
TACAGGAATTAAAACTAAACAAATAATTCCTTTTTACATGATTTGGTACAAAGAAGAAAA
ACAGGTGTTATAATAAACTTTATTAAAGTGATAAATAATAAATATCCTTAGAGCTAATTG
AAAAATAAATTTTTAATTGAGAAACAAGGAGATTTGGACTTTATGAAAAAATTTGTTTTA
ATGAAAAATGATGTTAATATGAATTGTATAGAATAAGCTGTTATTTTAAAGTTTTTTGAC
ATTTATAATCTTTTGGAGTAATTTTGTGTCAAAAATCTTAACTTTGATAAACAGCTCGTT
GAATTTTAAATTCCTGAGTATGATATCGTAGGAATCGAAGATTATTTAAAATCATTAAAA
GATAAAGTTTCAGAAAATGTTTACATGCAGGAAAAATAACACTATTGCTATCTAATAGAA
CCTGAAATGAAATTTAATCTTAACAGACCTTTATTAGAATAAATTATTTAGGAGGTAGAT
GAATCAAAAAAAGTAGAAATTTATGAGTTACACAATCAAAATGACTCTTAGTTCTATTAA
GAAATAAATAGTATTTCTTTTGATAAAAAACCATTACATATAAAAAATAAAATGAATTCT
TTACCTTCCATATTTGTAGATAAAGAAGAGTAACTTATAGAAAAAGTTATTCCAGATCTT
TTATAGCATTAAATCATAGGTATAGATCTAGAATATTGGACAGATAATAAAGATTAGAAA
TTATCTTTCATATGCACTCTATAATTGTCTACTTTATCATCAAATTTTGTTATCGATATT
CTTAATCTCAGTAAATCAGTATCTGTACATCTAAAGAGCATATTTGAATCTCCTAAATTT
GTTAAAGTATTTCATGGTGGTGAAACAGATTTAAAACTACTAAAAAAAGATTTAAACTTT
AATTTAGTAAATATATTTGATACTGCAAAAGCTTATCTTAAACAAAATAAAGGAGCTGGA
TCAGTTTCTTTAAGTTCTCTTAGTTAGTAGTATTTAAATTATAATGTTGATAAATAGTAC
TAAACTTCTGATTGGAGGATAAGACCTCTCCCAAAGCCGATGCTTAATTATGCAATGTAT
GATTCTTTTATAACTTTGATATTATTTTTTGTTATGAAATCTACAATATCCTAAGAAGAT
TTAAGCATAATAGCAATAAGTTGTAACAAAATGTGTATTAAATAGCTAGAAAAATCTTCG
TTTGATTTTAATAAACTATTTTTAATTAAAGATAACTAAAATATATAATGA


>TTHERM_01205350(protein)
MDQSINQQNWESLLVQELFNNEILDFIDNGLNTKPQQLLYLLFKLMQGLKLNKQHQNSNS
SESNSGFKLLHVEDENDDQKLEYFLKNTITTYDQNIQTIVNCQELVKAKEEQYKYLVRLD
DQIKQNCLKLEFSQQSQLYDFHQQCVNGQWKNYNLISFYLFISLGKSKIWPRLFKDIKSG
KKVERQWQIHQFFDQFRNDFSSIVKQGFNSSVISKKHQKEIDKQTIIQKSNNSFIQAVRD
NQFEKVQQMLVDGTNIEAIDTVEQFTAAHIACDVGNMEMIRLLDSYNCNWEALDHEQMTP
LYYAIRGENLPTVKFLVEEKKVNIEHKEFMHRTPFYWACCLGNLRIIRFLTEAGADINAK
TKLMRTALNKACFLGRADVVSYLLSQPQIDFEWGDTKGRNPLHNAIFGPRGGREGKKVGT
FGKDCPEAALLLLEKGVNVDAEDVDQSTPLHIACSSEALESIPLLIAYGADVNKQNKFGD
TALHFASRFGHIKTVIMLIEQFNALVLEDCKGFTGLDNALIGNHLDIYTYLIEKIAKEFI
QTPDQKYRHLKNLIKQHENKTQKLYLQLFLNNVVTIDDYQYFFSNEIIEMLPLLRDVDMF
DMLSQKFKPFFVEEDQIINLLLIVIKSRKIEFFNKLFESFIDVFQKFEFNNVNEILHNIL
EYNDREIVQIAFTLNLNIFDYRNQNQTNNSFLHDLVQRRKTGVIINFIKVINNKYPQSQL
KNKFLIEKQGDLDFMKKFVLMKNDVNMNCIEQAVILKFFDIYNLLEQFCVKNLNFDKQLV
EFQIPEYDIVGIEDYLKSLKDKVSENVYMQEKQHYCYLIEPEMKFNLNRPLLEQIIQEVD
ESKKVEIYELHNQNDSQFYQEINSISFDKKPLHIKNKMNSLPSIFVDKEEQLIEKVIPDL
LQHQIIGIDLEYWTDNKDQKLSFICTLQLSTLSSNFVIDILNLSKSVSVHLKSIFESPKF
VKVFHGGETDLKLLKKDLNFNLVNIFDTAKAYLKQNKGAGSVSLSSLSQQYLNYNVDKQY
QTSDWRIRPLPKPMLNYAMYDSFITLILFFVMKSTISQEDLSIIAISCNKMCIKQLEKSS
FDFNKLFLIKDNQNIQ


>TTHERM_01205350(gene)
ATGGATTAAAGTATTAACTAGTAAAACTGGGAATCTCTTCTTGTTTAAGAGCTTTTCAAC
AATGAAATCCTTGATTTTATAGATAATGGATTGAATACAAAACCTTAATAGCTTCTTTAC
CTACTTTTCAAGTTAATGTAGGGTTTAAAACTAAATAAATAACATCAAAATAGTAACTCA
TCAGAATCTAATTCTGGTTTCAAATTATTACATGTAGAAGATGAAAATGATGATTAAAAG
CTAGAATATTTTTTGAAAAATACAATAACTACTTATGATTAGAATATTTAAACTATTGTA
AATTGCTAAGAATTAGTTAAAGCAAAAGAGGAATAATATAAATATTTAGTTAGATTAGAT
GATTAAATAAAATAAAATTGTTTGAAGCTTGAATTTAGCTAACAGAGTTAGCTATATGAT
TTTCATTAATAATGTGTGAATGGCTAATGGAAAAATTACAATCTTATTTCATTTTATCTA
TTTATCTCTCTGGGAAAAAGTAAGATATGGCCCAGACTATTCAAAGATATAAAATCTGGT
AAAAAAGTTGAGCGTCAATGGCAAATACATTAATTTTTCGATTAATTTAGGTAATTTTAA
GATATTGTCATTTTTAAAGTTTAAAAGTTTGTAATTTAATTGTTAAACTATTAATTCTTA
ATAGAAATGACTTTAGTAGCATTGTTAAATAAGGCTTTAATTCATCTGTCATATCAAAGA
AGCATCAAAAGGAAATTGACAAACAAACAATCATTCAAAAAAGCAATAACTCCTTTATAT
AAGCTGTTAGGGATAATCAATTTGAAAAAGTCTAGTAAATGCTAGTAGATGGTACAAACA
TAGAAGCAGTAACAAAAACAACTTTTTTCTAATCCCTAATTTACAATTTATTTTTTGGAT
AACTAAATAAAATAGATTGATACAGTAGAATAATTTACAGCAGCACATATTGCTTGTGAT
GTGGGTAATATGGAAATGATAAGATTACTTGATTCTTACAATTGTAATTGGGAAGCCCTA
GACCATGAATAAATGACACCGTTATATTATGCTATAAGAGGAGAAAATTTACCTACTGTC
AAATTTTTAGTTGAAGAAAAAAAGGTTAATATAGAACATAAAGAATTCATGCATAGAACT
CCTTTTTACTGGGCTTGCTGCCTAGGAAAGTAATTATTCAAACAAAAAATTAAATTACAT
AGACACTTTAATTAAGTCTAGACGCTATTAACAAACCTTAAATCAAATTATTTTAAAAGC
CTTAGGATCATAAGATTTTTAACAGAAGCAGGAGCAGACATCAATGCAAAGACTAAACTA
ATGAGAACAGCACTTAATAAAGCTTGCTTTCTTGGAAGAGCAGATGTAGTTTCCTACCTC
TTATCTCAGCCTTAAATAGATTTTGAATGGGGAGATACTAAAGGAAGAAATCCACTTCAT
AACGCTATTTTTGGTCCTCGAGGTGGCAGGGAAGGAAAAAAAGTAGTTCCAAAAGGACTT
AATTTACAAGTCTAAATAATTAAAATATTTTTTGAATTTGCCTTAATTTGGTTTAATTCA
AATAATAAAGTAAAAACTTTAAAAAAATAATTCTTTATTAATTAAATATAGGTGGGAACT
TTTGGAAAGGATTGCCCTGAAGCTGCTCTTCTACTTTTAGAGAAAGGGGTAAATGTTGAT
GCTGAAGATGTTGATTAATCTACTCCTTTACATATAGCCTGTAGCTCTGAAGCATTGGAA
AGTATTCCTCTTTTAATTGCATATGGCGCAGATGTAAATAAACAAAATAAGGTATTTTAT
AAAAATTAAATAAATTTTAGAAAATTTAAAACTTTAATAAATCTAAGTTTGGTGATACAG
CCTTGCATTTTGCTTCTCGTTTCGGACATATTAAAACAGTTATTATGCTCATAGAATAGT
TTAATGCTCTAGTTTTAGAAGACTGTAAAGGGTAATTAATAACATCAAAAACTAAAAATT
TTTAATTTTAAATATTAAACAAACAGATTTACAGGATTAGACAACGCTCTTATTGGTAAT
CATCTTGACATTTATACATATTTAATTGAAAAAATAGCGAAAGAATTCATTTAAACGCCA
GATTAAAAATATCGACATCTTAAGAATTTAATAAAGTAGCATGAGAATAAAACTCAAAAA
CTGTATCTTTAATTATTCCTAAATAATGTTGTAACTATTGATGATTATTAATACTTTTTT
TCAAATGAAATTATTGAAATGCTTCCCTTGCTTAGGGATGTTGATATGTTTGATATGCTT
TCTTAAAAATTCAAACCATTTTTTGTTGAAGAAGATTAAATTATAAATTTGCTGCTGATT
GTAATTAAATCAAGGAAAATTGAGTTTTTTAACAAATTATTTGAAAGTTTTATAGATGTC
TTTTAGAAATTTGAATTTAATGTAAACAATTTGATCATTCATTTTATTTATCTATTCATT
CATTTTTTAATTTATTTATTTATTTTAATGCTAGAATGTAAATGAAATTTTACACAACAT
CCTAGAGTATAATGACAGAGAAATAGTTTAAATAGCATTTACTTTAAACTTAAATATCTT
TGATTACAGGAATTAAAACTAAACAAATAATTCCTTTTTACATGATTTGGTACAAAGAAG
AAAAACAGGTGTTATAATAAACTTTATTAAAGTGATAAATAATGTAAGAAAGATTTAAAT
AATTTCATAAAATTAATTTTATCTCTTTAATTTTTTTTAATTAGTTCAAATTATTCTTTT
AATTACTAAAATAAAAATTTATTTTATTCTTCTAAACTTGGAAAGTATTTAAAAATTAAT
TAATTAATTATATTTTAAATTAAAGAAATATCCTTAGAGCTAATTGAAAAATAAATTTTT
AATTGAGAAACAAGGAGATTTGGACTTTATGAAAAAATTTGTTTTAATGAAAAATGATGT
TAATATGAATTGTATAGAATAAGCTGTTATTTTAAAGTTTTTTGACATTTATAATCTTTT
GGAGTAATTTTGTGTCAAAAATCTTAACTTTGATAAACAGCTCGTTGAATTTTAAATTCC
TGAGTATGATATCGTAGGAATCGAAGATTATTTAAAATCATTAAAAGATAAAGTTTCAGA
AAATGTTTACATGCAGGAAAAATAACACTATTGCTATCTAATAGAACCTGAAATGAAATT
TAATCTTAACAGACCTTTATTAGAATAAATTATTTAGGTAAATTAATGATATATAATGTT
TAATAAAATAACTATATTAAAAATAGGAGGTAGATGAATCAAAAAAAGTAGAAATTTATG
AGTTACACAATCAAAATGACTCTTAGTTCTATTAAGAAATAAATAGTATTTCTTTTGATA
AAAAACCATTACATATAAAAAATAAAATGAATTCTTTACCTTCCATATTTGTAGATAAAG
AAGAGTAACTTATAGAAAAAGTTATTCCAGATCTTTTATAGCATTAAATCATAGGTATAG
ATCTAGAATATTGGACAGATAATAAAGATTAGAAATTATCTTTCATATGCACTCTATAAT
TGTCTACTTTATCATCAAATTTTGTTATCGATATTCTTAATCTCAGTAAATCAGTATCTG
TACATCTAAAGAGCATATTTGAATCTCCTAAATTTGTTAAAGTAAATTACTATTTTTATT
TTTAAAAAATGATAATAATATCTATTATTTAATAATTGCTGAATAAAGTTAATCCCTTAT
CGAATTATTTATATTTTAAATAAATTATATTTTTTAATAGGTATTTCATGGTGGTGAAAC
AGATTTAAAACTACTAAAAAAAGATTTAAACTTTAATTTAGTAAATATATTTGATACTGC
AAAAGCTTATCTTAAACAAAATAAAGGAGCTGGATCAGTTTCTTTAAGTTCTCTTAGTTA
GTAGTATTTAAATTATAATGTTGATAAATAGTACTAAACTTCTGATTGGAGGATAAGACC
TCTCCCAAAGCCGATGCTTAATTATGCAATGTATGATTCTTTTATAACTTTGATATTATT
TTTTGTTATGAAATCTACAATATCCTAAGAAGATTTAAGCATAATAGCAATAAGTTGTAA
CAAAATGTGTATTAAATAGCTAGAAAAATCTTCGTTTGATTTTAATAAACTATTTTTAAT
TAAAGATAACTAAAATATATAATGA