Identifiers and Description

Gene Model Identifier

TTHERM_00058820

Standard Name

AXE1 (Fusion of ankyrin/histone H3 methyl transferase and exosome 3-5 exoribonuclease.)

Aliases

PreTt13067 | 4.m00466 | 3707.m00111

Description

Fusion of ankyrin/histone H3 methyl transferase and exosome 3-5 exoribonuclease. 3'-5' exonuclease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00058820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01987.19.997093137033517e-2623-5 exonuclease (1059 aa)
OxytrichaContig6366.0.g398.001824328206442e-49Ankyrin repeats (3 copies)
DictyBaseDDB_G02715727.999528511121947e-28exosc10 on chromosome: 2 posit
ion 601251 to 605014
WormBaseWBGene000007964.0013320766793207e-25locus:crn-3 status:Confirmed
UniProt:G5EBX6 protein_id
:CAA90108.1
SGDYOR001W4.0006511639687014e-23RRP6 Nuclear exosome exonuclea
se component; has 3-5 exonucle
ase activity; involved in RNA
processing, maturation, survei
llance, degradation, tethering
, and export; has similarity t
o E. coli RNase D and to human
PM-Sc1 100 (EXOSC10); mutant
displays reduced transcription
elongation in the G-less-base
d run-on (GLRO) assay
Stentor CoeruleusSteCoe_128092.8625185805493937e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00058820(coding)
ATGTATAAAACAGAAGTTAATTTGCTTAATAAAATATGCAAAACAGATTATTTTAGTAAA
TTAAATACTAAACTTGACAATCTGGTTGATTATAATATCATTTTTAATGAATACTGCGAT
TTTTTAATGATTGAGAAATACTCCCTACTTTTAAATGAGCCTAGAATAAATTAATTTAAA
TATAATCAATTTTATTATGATGAAGTGAATCTCAGACAGCAGCTATTTTCCTAATTTTAA
CTAAGTCGAATTAACCAAACAATAAAGATTTCTAATATACTTGTTCAACCATATAGTAAC
AAGGGAACTTATCAATTAGTAAAAGACTTAGACTCTGAATTAGAAGCATAGGCTTATTTT
TTAGATAATACAGAATATTCTTTTTTAGATGTGATAGTCTTTTCTTCTTTACAAAAATGT
AGAATATGGCCAAAGCTCTACAAAGATGGGAAGAAGTCAAAAAAGGAATTACCTTAGCTT
ATTGATTGGTATAAAGTATTTATGAATACATACAAACATGAAATTGAATACTAATTTGAT
CCCAATATTGTGACAAGTAAATACTAAAAAAGACTAGAAATATAAAAGAAAGAAAAAAGA
TTAGATAAAAAATTAATTGAAGCTGTTTAAAGTAAATAATATGATTTAATCCGGAGTCTC
ATAGAAGAAGGCTCAGATATAGAAAGCATAGAGTAGTAGATGTACAAAAAACCAGCTCAT
ATAGCATGTGAACTAGGAGATATAGAGCTTTGTAGGTTTATAGACTAGTTTGGGTGTGAT
TGGGAATCATTAGATAATGAAGAATAGACTCCTATATTCTATGCAGTTACGAGTGGAAAT
TTAGAAGTTGTAAAATTTCTCATTGAAGAAAAAAATGTCAATCATTAACATAAAGAATTT
TAAGATAGGACTCCATTTTATTTGGCTTGTTTCTTAGGAAATATGCCTATTATTGAATAT
TTATATGAAAAAGGTGTGAATATTAATGAGCCATCAAAGCTCAAGCGCTGTGCACTAAGC
AAGGCTTGCTATTTAGGGCATGTAGAAGTAGTAAAATTCCTCGTATCGAAGCCTGAAACT
GATATTACTATGTAAGATTCTAAAGGTAGAACGGGGATGCATAATGCAGCATGGGGAATT
GAAGGTGGGAAAGAAGGAAAGAGGAGGGGAACTTTGAAACTCCCAGACTCTCCTTAATCT
ATAGAAATACTTCATGATTATGGTCATCCTATTGATTTTTAAGATTTTGAAGGAAACACT
CCTTTACTTAGTGCAGCATCCAGCGATGCAAGGGAATCCTTAAGAGTACTAATAAATAGA
GGCGCAAATAGAAATATTAGGAATTTTTATGGAGAAACTCCAGTCTTTTTAGCAGCTAAA
TATGGTCATACTGAGATCTTAAAAACCTTAATTAATGAATATAAATGTGATTGGGAAATG
AGAGATATTAGAAACACTACTCCTTGCGAAATAGCTGCTATAAACTAGAAATATGAATGT
TTTGATATACTTTTAAATTTAGAAATTCAAAACAATACAGTTAATGTTGAGAGTTTCATA
AAAAAAATCAATGATGACTACATCACTCATGAAGAATAACTTAAAATATTTGAATTGTAC
AATAGTAAAGTAGATATTAAGAATCGTATTTAAGATATAGAAAGTGTAATCTCTTTTTTG
ACTAATTGTACTAATCCATAATTAATGCTTAGAATTTAAGAAATAATATTAGATAGATTA
AATCCTTCTCACATTAAACAATTTTTCATTAACTTAGCTGATAATGGCAAGTATGATACA
GCATTTTAAATCTTAGAGACATTTGAATTAAAATATAAAGCTTCAGATAATCAAATTTAG
GGAATTCTGTTTGATCCATAAGAAATTTATAATTTTATTATTAAGGGAGTTAGTGCCACT
GATGAAACAATAAGTAAACTTCTATTTAAGGTTAATAGTGATTGGATCAATTACACAGAT
GATTCAACTAAAAATAACTTTTTACATATATTATGTGAATAGAGGAGAATGAAAATAATA
GTAGATTTAATTACCATAATCAAAGAAAAGAGCATTAATCCTGCTTACTCTTTTACATCT
AACATATATTTGCTAAATAATAATTAGTTTTACACATAGGATTTTGTTAGAAAATACTTA
AATGCAGTCAACTCTTAAAACTTAAATTCGTTAGATATATGTTTACTTTCAAAAGCAAAC
GACATTCATTTGATCATAGATAATTTTATTAGGAGCTTTCTTCATGAAGAACCTTCTTAT
CATTATGTTATACCAAGTTATGACTTTGAAATGATTTCCCAAAGAGACACAGATGTAAAA
TAAATTATTACACTTGAAGCCAATATATTTTTGTCTCAAACAATTCACTTATTTATATTT
TATTTTAAAATAAATTAGCATGCTTTAATCGGTGAATTAGAAGAAGAAGCGAAAAAGCTC
TAAGAACAAATCAAATAAAAAAGTGGAGATCTTTAGCATTTGAATTGTTATTCTTTCTTA
GACGACTTAAGTGTAATTGATTAGTAAAAAGTGACAGTTGAGGACAATTCAGAATAAAAC
CAGAACATTGAAAAATTATATCCAAATAGAAAGTTGTATTTTATAAATTAGATTGATTCA
GATGAATCAAGAATTCTTAAGGAAGAAATCGAAAAAAACAGTATTTTTGGTATTGACCTT
GAGTATTACTCTGAAAATAAAGATAAAAATCTAGGATTTGTATGTACTATTCAGATATCT
ACAGTTAATATGGATTTTATGATAGATGCTATGGCATTAAGAAATTAGATAAATTAATTA
CTAAATAAATCTCTCTTTTTAAATAAAACAAAAATTAAAATTTTGCATGGCTGCGAAAAC
GATATCAAGTGGCTTAAAAACGACTTCGATATTGATATAGTTAATCTATTTGATACAATG
TTTGCAGAAATGATTATTAAAAACAAGCAGCAATCTTACTCTCTCAAAAATTTATCTTAA
GACTATCTAGGTGTAGAACTAGATAAATCATATTAAATTTCAGATTGGAGAATTAGACCT
CTTCCAACTCCAATGATGAATTATGCAAGAGTCGATTCTTTTATTCTGTTGAGACTATTC
CCCATCATGAAATAAATGCTAACATCCAAAAATTTGTTAAATCAAATGTTCCTAAAGTGC
CTTCTTTTCATAATTCGTTAAAGCAATTCCAAAAAAACACAACAATTATAATAATGCTAG
TAAAATAATAATAAGTGA


>TTHERM_00058820(protein)
MYKTEVNLLNKICKTDYFSKLNTKLDNLVDYNIIFNEYCDFLMIEKYSLLLNEPRINQFK
YNQFYYDEVNLRQQLFSQFQLSRINQTIKISNILVQPYSNKGTYQLVKDLDSELEAQAYF
LDNTEYSFLDVIVFSSLQKCRIWPKLYKDGKKSKKELPQLIDWYKVFMNTYKHEIEYQFD
PNIVTSKYQKRLEIQKKEKRLDKKLIEAVQSKQYDLIRSLIEEGSDIESIEQQMYKKPAH
IACELGDIELCRFIDQFGCDWESLDNEEQTPIFYAVTSGNLEVVKFLIEEKNVNHQHKEF
QDRTPFYLACFLGNMPIIEYLYEKGVNINEPSKLKRCALSKACYLGHVEVVKFLVSKPET
DITMQDSKGRTGMHNAAWGIEGGKEGKRRGTLKLPDSPQSIEILHDYGHPIDFQDFEGNT
PLLSAASSDARESLRVLINRGANRNIRNFYGETPVFLAAKYGHTEILKTLINEYKCDWEM
RDIRNTTPCEIAAINQKYECFDILLNLEIQNNTVNVESFIKKINDDYITHEEQLKIFELY
NSKVDIKNRIQDIESVISFLTNCTNPQLMLRIQEIILDRLNPSHIKQFFINLADNGKYDT
AFQILETFELKYKASDNQIQGILFDPQEIYNFIIKGVSATDETISKLLFKVNSDWINYTD
DSTKNNFLHILCEQRRMKIIVDLITIIKEKSINPAYSFTSNIYLLNNNQFYTQDFVRKYL
NAVNSQNLNSLDICLLSKANDIHLIIDNFIRSFLHEEPSYHYVIPSYDFEMISQRDTDVK
QIITLEANIFLSQTIHLFIFYFKINQHALIGELEEEAKKLQEQIKQKSGDLQHLNCYSFL
DDLSVIDQQKVTVEDNSEQNQNIEKLYPNRKLYFINQIDSDESRILKEEIEKNSIFGIDL
EYYSENKDKNLGFVCTIQISTVNMDFMIDAMALRNQINQLLNKSLFLNKTKIKILHGCEN
DIKWLKNDFDIDIVNLFDTMFAEMIIKNKQQSYSLKNLSQDYLGVELDKSYQISDWRIRP
LPTPMMNYARVDSFILLRLFPIMKQMLTSKNLLNQMFLKCLLFIIRQSNSKKTQQLQQCQ
QNNNK


>TTHERM_00058820(gene)
TATCAATCATAAAACTCACTCATAAAAATTAATAAAAGATTCATTTTAAAAAATCTTAAT
ATTTACAAACTTTAAACACTCTTTAAAAAGCAAATGTATAAAACAGAAGTTAATTTGCTT
AATAAAATATGCAAAACAGATTATTTTAGTAAATTAAATACTAAACTTGACAATCTGGTT
GATTATAATATCATTTTTAATGAATACTGCGATTTTTTAATGATTGAGAAATACTCCCTA
CTTTTAAATGAGCCTAGAATAAATTAATTTAAATATAATCAATTTTATTATGATGAAGTG
AATCTCAGACAGCAGCTATTTTCCTAATTTTAACTAAGTCGAATTAACCAAACAATAAAG
ATTTCTAATATACTTGTTCAACCATATAGTAACAAGGGAACTTATCAATTAGTAAAAGAC
TTAGACTCTGAATTAGAAGCATAGGCTTATTTTTTAGATAATACAGAATATTCTTTTTTA
GATGTGATAGTCTTTTCTTCTTTACAAAAATGTAGAATATGGTACAATTTATTGATTTAA
ATGAATTAAATTTAGCAATCCTTTTTACCATACAATAAATAACTTTATTATCAAAACAAA
ATCAGGCCAAAGCTCTACAAAGATGGGAAGAAGTCAAAAAAGGAATTACCTTAGCTTATT
GATTGGTATAAAGTATTTATGAATACATACAAACATGAAATTGAATACTAATTTGATCCC
AATATTGTGACAAGTAAATACTAAAAAAGACTAGAAATATAAAAGAAAGAAAAAAGATTA
GATAAAAAATTAATTGAAGCTGTTTAAAGTAAATAATATGATTTAATCCGGAGTCTCATA
GAAGAAGGCTCAGATATAGAAAGCATAGAGTAGTAGATGTACAAAAAACCAGCTCATATA
GCATGTGAACTAGGAGATATAGAGCTTTGTAGGTTTATAGACTAGTTTGGGTGTGATTGG
GAATCATTAGATAATGAAGAATAGACTCCTATATTCTATGCAGTTACGAGTGGAAATTTA
GAAGTTGTAAAATTTCTCATTGAAGAAAAAAATGTCAATCATTAACATAAAGAATTTTAA
GATAGGACTCCATTTTATTTGGCTTGTTTCTTAGGAAATATGCCTATTATTGAATATTTA
TATGAAAAAGGTGTGAATATTAATGAGCCATCAAAGCTCAAGCGCTGTGCACTAAGCAAG
GCTTGCTATTTAGGGCATGTAGAAGTAGTAAAATTCCTCGTATCGAAGCCTGAAACTGAT
ATTACTATGTAAGATTCTAAAGGTAGAACGGGGATGCATAATGCAGCATGGGGAATTGAA
GGTGGGAAAGAAGGAAAGAGGAGGGGAACTTTGAAACTCCCAGACTCTCCTTAATCTATA
GAAATACTTCATGATTATGGTAAACTTATGGTATTATGTAAGACTTTTTAAAAAAAAAGA
ATTATTTTTATTAAAAAAAGGTCATCCTATTGATTTTTAAGATTTTGAAGGAAACACTCC
TTTACTTAGTGCAGCATCCAGCGATGCAAGGGAATCCTTAAGAGTACTAATAAATAGAGG
CGCAAATAGAAATATTAGGAATTTTTATGGAGAAACTCCAGTCTTTTTAGCAGCTAAATA
TGGTCATACTGAGATCTTAAAAACCTTAATTAATGAATATAAATGTGATTGGGAAATGAG
AGATATTAGAAACACTACTCCTTGCGAAATAGCTGCTATAAACTAGAAATATGAATGTTT
TGATATACTTTTAAATTTAGAAATTCAAAACAATACAGTTAATGTTGAGAGTTTCATAAA
AAAAATCAATGATGACTACATCACTCATGAAGAATAACTTAAAATATTTGAATTGTACAA
TAGTAAAGTAGATATTAAGAATCGTATTTAAGATATAGAAAGTGTAATCTCTTTTTTGAC
TAATTGTACTAATCCATAATTAATGCTTAGAATTTAAGAAATAATATTAGATAGATTAAA
TCCTTCTCACATTAAACAATTTTTCATTAACTTAGCTGATAATGGCAAGTATGATACAGC
ATTTTAAATCTTAGAGACATTTGAATTAAAATATAAAGCTTCAGATAATCAAATTTAGGG
AATTCTGTTTGATCCATAAGAAATTTATAATTTTATTATTAAGGGAGTTAGTGCCACTGA
TGAAACAATAAGTAAACTTCTATTTAAGGTTAATAGTGATTGGATCAATTACACAGATGA
TTCAACTAAAAATAACTTTTTACATATATTATGTGAATAGAGGAGAATGAAAATAATAGT
AGATTTAATTACCATAATCAAAGAAAAGAGCATTAATCCTGCTTACTCTTTTACATCTAA
CATATATTTGCTAAATAATAATTAGTTTTACACATAGGATTTTGTTAGAAAATACTTAAA
TGCAGTCAACTCTTAAAACTTAAATTCGTTAGATATATGTTTACTTTCAAAAGCAAACGA
CATTCATTTGATCATAGATAATTTTATTAGGAGCTTTCTTCATGAAGAACCTTCTTATCA
TTATGTTATACCAAGTTATGACTTTGAAATGATTTCCCAAAGAGACACAGATGTAAAATA
AATTATTACACTTGAAGCCAATATATTTTTGTCTCAAACAATTCACTTATTTATATTTTA
TTTTAAAATAAATTAGCATGCTTTAATCGGTGAATTAGAAGAAGAAGCGAAAAAGCTCTA
AGAACAAATCAAATAAAAAAGTGGAGATCTTTAGCATTTGAATTGTTATTCTTTCTTAGA
CGACTTAAGTGTAATTGATTAGTAAAAAGTGACAGTTGAGGACAATTCAGAATAAAACCA
GAACATTGAAAAATTATATCCAAATAGAAAGTTGTATTTTATAAATTAGATTGATTCAGA
TGAATCAAGAATTCTTAAGGAAGAAATCGAAAAAAACAGTATTTTTGGTATTGACCTTGA
GTATTACTCTGAAAATAAAGATAAAAATCTAGGATTTGTATGTACTATTCAGATATCTAC
AGTTAATATGGATTTTATGATAGATGCTATGGCATTAAGAAATTAGATAAATTAATTACT
AAATAAATCTCTCTTTTTAAATAAAACAAAAATTAAAATTTTGCATGGCTGCGAAAACGA
TATCAAGTGGCTTAAAAACGACTTCGATATTGATATAGTTAATCTATTTGATACAATGTT
TGCAGAAATGATTATTAAAAACAAGCAGCAATCTTACTCTCTCAAAAATTTATCTTAAGA
CTATCTAGGTGTAGAACTAGATAAATCATATTAAATTTCAGATTGGAGAATTAGACCTCT
TCCAACTCCAATGATGAATTATGCAAGAGTCGATTCTTTTATTCTGTTGAGACTATTCCC
CATCATGAAATAAATGCTAACATCCAAAAATTTGTTAAATCAAATGTTCCTAAAGTGCCT
TCTTTTCATAATTCGTTAAAGCAATTCCAAAAAAACACAACAATTATAATAATGCTAGTA
AAATAATAATAAGTGAAATATATTTAATCTATTAACAAATATTTAAAACATTTTTATTCT
TAATAAATTGAATGTACTATAATAATTAACAATACAT