Identifiers and Description

Gene Model Identifier

TTHERM_00283800

Standard Name

AVP1 (Autophagic Vacuolar Protein 1)

Aliases

PreTt04919 | 25.m00383 | 3694.m00166

Description

Kelch motif family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 64.2%

TetraMine Data

TTHERM_00283800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09016.12.000555387360374e-52kelch domain-containing protei
n family protein (998 aa)
Stentor CoeruleusSteCoe_188315.5210822770285325e-42
DictyBaseDDB_G02807651.0004783691736523e-35DDB_G0280765 on chromosome: 3
position 3715566 to 3718006
OxytrichaContig20300.0.1.g628.000293710285615e-35Galactose oxidase, central dom
ain
SGDYGR238C2.0008113830639685e-30KEL2 Protein that functions in
a complex with Kel1p to negat
ively regulate mitotic exit, i
nteracts with Tem1p and Lte1p;
localizes to regions of polar
ized growth; potential Cdc28p
substrate
WormBaseWBGene000064987.002638123733849e-21locus:ten-1 Teneurin-1 sta
tus:Confirmed UniProt:G5EGQ6
protein_id:CCD70183.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00283800(coding)
ATGAAATTACTATCATATTTCTGCGGGTTAGTGATTATGTTTGAACTAAGTTTCATTTTG
GCTATAAAAAAAGAATATTAAGATAACATGATGGAGGATTAGGACGGTATTAAAATTATT
ATGGAAAGTTCTCATTCTAAGAAAAATAAATTGCATGATACTCTATCAATAGATAATGAT
AAATCATCAAAAAAAGAATATTTTGATTAAAAATAAGTATTTGATTATTTTTCATTAGTT
AAAAATAAAAAAACAGCTGATTAAGATGAAGATAACTCTGATAGTGAAGAAGAAGAAGAT
GTTTCAAGCATAGAAAATGATGAAATAAATTCATAAAAGGAATAAAGTGAAGAAACAACA
AGTGATCAAACTAAAGAAGATAAACAAAAAACTTAAACAAATTCCAACAATGAAAATAAA
GAATAATCTTAAGACTAAGACTAATAATAACCAAAATAACTTGTATTATAACTTAAAGGC
TCAGATAGCTAAATTATATAAAAGGAAGATGGGGAAATATATTTTCTTCGATATGACCCA
GTTAGTTAAACAACATAAATGATGAACATGAATAAAATCAAAGAAGTTGACTTTAAAAAT
AGTAAAATGGTTGTAGATACATCTACTTCAGATAAGCAAAAATTATAAAAGTATACTATT
CCTACATACGATCCTTTTGAGTGGTTTTAAGTTTTATCTGAAGGTGAAATTCCACAAAGA
AGAGGTGGTCACACTTTAATTGCTGTTGGTTAAACAATAATCCTTTTCGGTGGATGCCTT
TAAGACATCTAGTGTTTTAATGATTTATACTTCTATGATATCATGGAGCTCACTTGGTCT
ACTTCTAAGATATTTGGTGAACCTCCAAGCCCTAGAAGTGGTCACTCAGCTACTTTAGTT
GGATCTTATCTTTATATTTTCGGTGGATCTAACCAACATGGTATATTAAGCGACCTGCAT
AGACTTAATTTGGCTAGTAGAGTATGGGAATAATTTGAATTTGAAGGACCCAAGCCACCT
GGAAGAACAAACCATAAAGCTATATTAGATAATCAGGGAAGAATTGTTTTCTTTGGAGGT
TTTACAGTACAAGGATATTCTAGCGATGTCTATTTTCTTGATTTAGTCAATCTTAGATGG
GTTAAGCCACTCGTAAATGGAGAACCACCTCGCCCAAGAGAGAATTTTTCCATGAATCTC
GTACGTGATTCTTATATTTGGATATTTGGAGGCTACTGTCTTGGAGGAGAAACGAATGAT
TTATGGCAACTAGATGTAGAAAATATGAGATGGACTAAGATTTTAGAAAGTTATGGCACT
AAACCAATTGAGAGACAGGGGCATTAAATGGTTCTTCATGGAAAACTACTTTATACATTA
GGTGGCTGCAATTACAAGGAATAAAGATGCTTCAACGATGTTTATTAATTAAATATTGAT
GATTTGACATGGACTAAATTAGATTTTGTACTTGAGAACACTCTTAAAGAAAGAGATAAC
TATGGTCTAACATTAATGGGGTCTAATCTTTATCTTTTTGGGGGTTGTTAAATGATGGAA
AAGTGCTACAACGATTTCTTAGTAATGAATATAACTGATATTTGTCCTAAAAACTGCACT
GGAAGAGGTATTTGTAGAAACAATAGATGCTAATGCTAGGAGGGGTTTTTTGGTGAATAA
TGCGAAATTGAAATGCATTGTGAGTATAATTGCTCAAACAGAGGTATTTGTGGAACTGAT
GGCAATTGCAAGTGCTACAGCGGATTTGCAGGTAAAGTATGCGAATTGTATATTCCTTGT
CCATCGAACTGTACCAGCATAGATAATGGCTTGTGTTAATCAAATGGACTTTGCTAGTGT
AATCAAGGATATAAAGGATTAGCTTGTGAAATTGGATAAAAAGGATTACTTGATATAGAA
GTTAAATGCCCTAAAAATTGCAGCAATCGAGGAAAATGCAATGAAATAACAGGAATATGC
ATATGTGAAGATGGCTATGGTGATCTAGATTGCTCACTCACAATCGAAGCATGGGAGTAG
AAATAAAAAGAGAAAGAATAAAAGAAAATAGAAGAGGAATTAAAGAAAAAATAAGAAGAA
TTAAAGAAAAATGAAGGAAACAAAGACAAATAAGAAGATGAAGCCAACAAAGAAAGTTAA
TAGGAATCTTAAAATCCAAAAGAGTAAGTGAATGAAGGAGATAAAATAAATGTATCAAAT
GTAGATGCAGGATAAGAAGCATAATAATCATCACCTGATTAGAATACATAATAAAATTAA
GATACATCATCTGAGGAGGAGTCTAAGTTGTAAGCTGATTAACAGTAATCTTAAAAAACA
AATGATTTGGATGAAGAAAATGATAAAACATCTGATGGTGATGAAAACTAGGAATAAAAA
GGAGATAGCTAAATTGATGAGTTATAAAATGTATCAGAATCAAAAAATGAAGAATCAGAT
TTAAGCTAACAAGATTTATCTAAAAGTGAAGAAATTGCTAAGCTTATTCACATGGCCTTA
AAAGCAAATCAGAAATAAGAATAAGTATCAAATCTCTCTGACTGTGAAAATAGCTGTTCA
TTTAATGGAGTGTGCTATAAATAAGAGTGTTATTGTAAACCTGGCTTCACTGGAGAAGAT
TGTTCTGCATATAAAATATCTTAACTTCATAAAGGAATCAAAGCAATTAAGCTGGTATTT
TATATTCCTATCTTCTTAATAATCGGAATTATTATAGGGTACTACTACATTAAATAAGCT
TAGTCAGAGTAAGAAGAGTAAGAGTTTGGTGAAATCGAAGACTATAAAGAGGAATAAAAG
AGATAAAGTATCTTGGCTCTAAACATGAACTAAAATTCTGACAATAAAAAACTTATTTAT
ATTGAGGACAATAACGACGAAGAAGATTCTGTATCATTTATAAAAGAGAGAGTTTCTAAT
AGCGAAGTCTCAGATATATCAGAACATACACACAAAGAATAAGAAGTAAAAAGCTTATAA
CAGATTTAGAAATAAAATTCATAGGAGTCCCCAGAAATAAATCAAAAAAATTCTAATTAA
TAATCAGTCATTTTAGGATAGAAAGAATCTTCCATCTAACCTTCATAATAAAACGAAAAA
CAATCTAATATATTTATTAGAAATCCTAACAAACAAAGTGTAGAAGACCCCTTCTCAAAT
AATTGA


>TTHERM_00283800(protein)
MKLLSYFCGLVIMFELSFILAIKKEYQDNMMEDQDGIKIIMESSHSKKNKLHDTLSIDND
KSSKKEYFDQKQVFDYFSLVKNKKTADQDEDNSDSEEEEDVSSIENDEINSQKEQSEETT
SDQTKEDKQKTQTNSNNENKEQSQDQDQQQPKQLVLQLKGSDSQIIQKEDGEIYFLRYDP
VSQTTQMMNMNKIKEVDFKNSKMVVDTSTSDKQKLQKYTIPTYDPFEWFQVLSEGEIPQR
RGGHTLIAVGQTIILFGGCLQDIQCFNDLYFYDIMELTWSTSKIFGEPPSPRSGHSATLV
GSYLYIFGGSNQHGILSDLHRLNLASRVWEQFEFEGPKPPGRTNHKAILDNQGRIVFFGG
FTVQGYSSDVYFLDLVNLRWVKPLVNGEPPRPRENFSMNLVRDSYIWIFGGYCLGGETND
LWQLDVENMRWTKILESYGTKPIERQGHQMVLHGKLLYTLGGCNYKEQRCFNDVYQLNID
DLTWTKLDFVLENTLKERDNYGLTLMGSNLYLFGGCQMMEKCYNDFLVMNITDICPKNCT
GRGICRNNRCQCQEGFFGEQCEIEMHCEYNCSNRGICGTDGNCKCYSGFAGKVCELYIPC
PSNCTSIDNGLCQSNGLCQCNQGYKGLACEIGQKGLLDIEVKCPKNCSNRGKCNEITGIC
ICEDGYGDLDCSLTIEAWEQKQKEKEQKKIEEELKKKQEELKKNEGNKDKQEDEANKESQ
QESQNPKEQVNEGDKINVSNVDAGQEAQQSSPDQNTQQNQDTSSEEESKLQADQQQSQKT
NDLDEENDKTSDGDENQEQKGDSQIDELQNVSESKNEESDLSQQDLSKSEEIAKLIHMAL
KANQKQEQVSNLSDCENSCSFNGVCYKQECYCKPGFTGEDCSAYKISQLHKGIKAIKLVF
YIPIFLIIGIIIGYYYIKQAQSEQEEQEFGEIEDYKEEQKRQSILALNMNQNSDNKKLIY
IEDNNDEEDSVSFIKERVSNSEVSDISEHTHKEQEVKSLQQIQKQNSQESPEINQKNSNQ
QSVILGQKESSIQPSQQNEKQSNIFIRNPNKQSVEDPFSNN


>TTHERM_00283800(gene)
ATGAAATTACTATCATATTTCTGCGGGTTAGTGATTATGTTTGAACTAAGTTTCATTTTG
GCTATAAAAAAAGAATATTAAGATAACATGATGGAGGATTAGGACGGTATTAAAATTATT
ATGGAAAGTTCTCATTCTAAGAAAAATAAATTGCATGATACTCTATCAATAGATAATGAT
AAATCATCAAAAAAAGAATATTTTGATTAAAAATAAGTATTTGATTATTTTTCATTAGTT
AAAAATAAAAAAACAGCTGATTAAGATGAAGATAACTCTGATAGTGAAGAAGAAGAAGAT
GTTTCAAGCATAGAAAATGATGAAATAAATTCATAAAAGGAATAAAGTGAAGAAACAACA
AGTGATCAAACTAAAGAAGATAAACAAAAAACTTAAACAAATTCCAACAATGAAAATAAA
GAATAATCTTAAGACTAAGACTAATAATAACCAAAATAACTTGTATTATAACTTAAAGGC
TCAGATAGCTAAATTATATAAAAGGAAGATGGGGAAATATATTTTCTTCGATATGACCCA
GTTAGTTAAACAACATAAATGATGAACATGAATAAAATCAAAGAAGTTGACTTTAAAAAT
AGTAAAATGGTTGTAGATACATCTACTTCAGATAAGCAAAAATTATAAAAGTATACTATT
CCTACATACGATCCTTTTGAGTGGTTTTAAGTTTTATCTGAAGGTGAAATTCCACAAAGA
AGAGGTGGTCACACTTTAATTGCTGTTGGTTAAACAATAATCCTTTTCGGTGGATGCCTT
TAAGACATCTAGTGTTTTAATGATTTATACTTCTATGATATCATGTAATTTATTTACCTA
ACTAAATATATTTATCCAAGTTTTTATAATCTTTTCATTTTTAATTTTAGGGAGCTCACT
TGGTCTACTTCTAAGATATTTGGTGAACCTCCAAGCCCTAGAAGTGGTCACTCAGCTACT
TTAGTTGGATCTTATCTTTATATTTTCGGTGGATCTAACCAACATGGTATATTAAGCGAC
CTGCATAGACTTAATTTGGCTAGTGTAATTTTCTAACAAGAAATTTAAAGAATATTTATA
TAAATATTATTATTTAATAAAGAGAGTATGGGAATAATTTGAATTTGAAGGACCCAAGCC
ACCTGGAAGAACAAACCATAAAGCTATATTAGATAATCAGGGAAGAATTGTTTTCTTTGG
AGGTTTTACAGTATAGTTTATTTTGATAAATATTTATTTAGTAAATTTTGAATAAAAAAT
AAGGTACAAGGATATTCTAGCGATGTCTATTTTCTTGATTTAGTCAATCTTAGATGGGTT
AAGCCACTCGTAAATGGAGAACCACCTCGCCCAAGAGAGAATTTTTCCATGAATCTCGTA
CGTGATTCTTATATTTGGATATTTGGAGGCTACTGTCTTGGAGGAGAAACGAATGATTTA
TGGCAACTAGATGTAGAAAATATGAGATGGACTAAGATTTTAGAAAGTTATGGCACTAAA
CCAATTGAGAGACAGGGGCATTAAATGGTTCTTCATGGAAAACTACTTTATACATTAGGT
GGCTGCAATTACAAGGAATAAAGATGCTTCAACGATGTTTATTAATTAAATATTGATGAT
TTGACATGGACTAAATTAGATTTTGTACTTGAGTAAATAAATAAATAACTTAATCATCAT
AATTTGATATTAATTTTTAACATTTTAAAAAGGAACACTCTTAAAGAAAGAGATAACTAT
GGTCTAACATTAATGGGGTCTAATCTTTATCTTTTTGGGGGTTGTTAAATGATGGAAAAG
TGCTACAACGATTTCTTAGTAATGAATATAACTGATATTTGTCCTAAAAACTGCACTGGA
AGAGGTATTTGTAGAAACAATAGATGCTAATGCTAGGAGGGGTTTTTTGGTATTATTTTT
TTTTATCTAAAAATTGGAAATTTTATTCCTAATTATTCTTAAAAAAGGTGAATAATGCGA
AATTGAAATGCATTGTGAGTATAATTGCTCAAACAGAGGTATTTGTGGAACTGATGGCAA
TTGCAAGTGCTACAGCGGATTTGCAGGTAAAGTATGCGAATTGTATATTCCTTGTCCATC
GAACTGTACCAGCATAGATAATGGCTTGTGTTAATCAAATGGACTTTGCTAGTGTAATCA
AGGATATAAAGGATTAGCTTGTGAAATTGGATAAAAAGGATTACTTGATATAGAAGTTAA
ATGCCCTAAAAATTGCAGCAATCGAGGAAAATGCAATGAAATAACAGGAATATGCATATG
TGAAGTATCATTTAAAATTAATACTGTTTTAAGCGATATTAATTAATTTATTTATTTATT
TAGGATGGCTATGGTGATCTAGATTGCTCACTCACAATCGAAGCATGGGAGTAGAAATAA
AAAGAGAAAGAATAAAAGAAAATAGAAGAGGAATTAAAGAAAAAATAAGAAGAATTAAAG
AAAAATGAAGGAAACAAAGACAAATAAGAAGATGAAGCCAACAAAGAAAGTTAATAGGAA
TCTTAAAATCCAAAAGAGTAAGTGAATGAAGGAGATAAAATAAATGTATCAAATGTAGAT
GCAGGATAAGAAGCATAATAATCATCACCTGATTAGAATACATAATAAAATTAAGATACA
TCATCTGAGGAGGAGTCTAAGTTGTAAGCTGATTAACAGTAATCTTAAAAAACAAATGAT
TTGGATGAAGAAAATGATAAAACATCTGATGGTGATGAAAACTAGGAATAAAAAGGAGAT
AGCTAAATTGATGAGTTATAAAATGTATCAGAATCAAAAAATGAAGAATCAGATTTAAGC
TAACAAGATTTATCTAAAAGTGAAGAAATTGCTAAGCTTATTCACATGGCCTTAAAAGCA
AATCAGAAATAAGAATAAGTATCAAATCTCTCTGACTGTGAAAATAGCTGTTCATTTAAT
GGAGTGTGCTATAAATAAGAGTGTTATTGTAAACCTGGCTTCACTGGAGAAGATTGTTCT
GCATATAAAATATCTTAACTTCATAAAGGAATCAAAGCAATTAAGCTGGTATTTTATATT
CCTATCTTCTTAATAATCGGAATTATTATAGGTAAATCATTTTTTTTATTAATTTATTCA
CAACACATTAACAATAAAAAAATTAGGGTACTACTACATTAAATAAGCTTAGTCAGAGTA
AGAAGAGTAAGAGTTTGGTGAAATCGAAGACTATAAAGAGGAATAAAAGAGATAAAGTAT
CTTGGCTCTAAACATGAACTAAAATTCTGACAATAAAAAACTTATTTATATTGAGGACAA
TAACGACGAAGAAGATTCTGTATCATTTATAAAAGAGAGAGTTTCTAATAGCGAAGTCTC
AGATATATCAGAACATACACACAAAGAATAAGAAGTAAAAAGCTTATAACAGATTTAGAA
ATAAAATTCATAGGAGTCCCCAGAAATAAATCAAAAAAATTCTAATTAATAATCAGTCAT
TTTAGGATAGAAAGAATCTTCCATCTAACCTTCATAATAAAACGAAAAACAATCTAATAT
ATTTATTAGAAATCCTAACAAACAAAGTGTAGAAGACCCCTTCTCAAATAATTGA