Identifiers and Description

Gene Model Identifier

TTHERM_00334280

Standard Name

AUR1 (AURora kinase 1)

Aliases

PreTt05973 | 34.m00210 | 3689.m00008

Description

plant dual-specificity MAP kinase kinase family domain protein; Streptococcal surface antigen repeat family protein. Sequence similarity to the Aurora protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01920 ) Prefoldin subunit
  • ( PF00069 ) protein kinase domain
  • ( TIGR00517 ) acyl carrier protein
  • ( PF07714 ) protein tyrosine kinase
  • ( PF04702 ) Vicilin N terminal region
  • ( PF08614 ) Autophagy protein 16 (ATG16)
  • ( PF06696 ) Streptococcal surface antigen repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13%

TetraMine Data

TTHERM_00334280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16019.19.997093137033517e-262kinase domain-containing prote
in (745 aa)
OxytrichaContig1407.0.g121.0003180480544985e-86Protein kinase domain
WormBaseWBGene000000982.998990600740728e-62locus:air-1 status:Confirmed
UniProt:G5EDL3 protein_id
:CCD64757.1
DictyBaseDDB_G02793437.998673901528599e-62aurK on chromosome: 3 position
1959552 to 1961164
SGDYKL166C5.997545490783615e-57TPK3 cAMP-dependent protein ki
nase catalytic subunit; promot
es vegetative growth in respon
se to nutrients via the Ras-cA
MP signaling pathway; partiall
y redundant with Tpk1p and Tpk
2p; localizes to P-bodies duri
ng stationary phase
Stentor CoeruleusSteCoe_94137.47197233734299e-43

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00334280(coding)
ATGCAAAATATTGGGTTAAATTAAGTTAAAGATAGAATCCTTATACTAAGTCCTATAGTA
TAAGGGCGACTTGAAAGTGAGTTAAAAACCTCAGACTTTTAAGTTTTGGATAGATTAGGC
AAAGGAGCATTTGGCAAAGTTTACAAAACAAAACTATAAAAAACAGGATAGATTTTTGCA
TTAAAATAAATGGAAAAATAGCAAATATTGAAGTAAGGTATGGTAAAGCAAATCTAAACA
GAGGTGAAAGTTATGTATAGCTTGGATCATCCTAATATAATAAAACTATATAATCATTTT
GAAGAAGATGCCTATATTTATTTAATGATTGAATATGCATCAGGTGGTTAACTTTGGTAA
AAACTAACAAAAGAAGGTAGATTTGATGAAAACACAGTTAAAAGATATATGGCTGATATC
ATCCTTGCTGTTGAATATTTACATAGCTAAAACCCTCCAATTATTCATCGTGATATAAAA
CCTGAAAATTTAATCTTAGATGAAAACGGAAGAGTTAAATTAGTAGATTTTGGTTGGTCA
AACTTTAAAAATCGTCTGCGTATGACTTACTGTGGAACTCTTGATTATCTTGCCCCAGAA
ATGATTTTAGAATTAGGGCACGATGAAAAGTTAGATATCTGGAGTCTCGGTGTTTTGATT
TTTGAATTAATCACAGGGAAAGCTCCATTTGCTCCAAAGGTCGAGAATGCTAACATTGAT
TAAAACCAAGCAAGGTAAATATTAGAAGACAATATATTAAAAGTTAAACTTGACTATCCA
AACGACTTTCCTCAATTAGCTAAAGATTTAGTTAATAATTTATGTAAAAAAGAACCTAAT
TAGCGTAAAACACTTCCTGAAATAAAAAAGCACCCATGGTTTATAATTGAAAGCGAAGGT
AAAAACATTTTTGAAATGGAACCTTGGAATTATAGACCTCTTGCAAGTTAAAAGTATAAA
TATTGCTTAACACCAAATTAAATTAATCCCCTTAAGCTTGAAGGAGGTTTTACACCATAA
TTTATTGCCGATTTTGCTACTCGCTTACATTAGCCTTTAGTAATGAATATCCTTCAACAA
ATAGCTTAAAAAAGCTAGTAGAATGGTAATGCTAATCCTTAACTTACATAAAGTGGTTAA
AGCTAAAATATGAATGCATCTTAAACTAGCTAATAAAACTAAAGCAATTATGAGGAAGAA
ATTTTAAATCTCAAAAAGAAAATTGCTTCTAGGGAATAAGAAAAATAAGACCTTGAATCG
TAAAAAAAAGAATTGATAGTAAAATTAGAAGTGAAAGAAAGGGAAAATACTAAGTTAAAA
GATGAATTAGATAAATATAAATCAATAGGGCAAGACTCAACTCCAACTGAGCAGAGAAGT
GTTGGAGTCAGTGGAGTTAATGGAGGAATAATTGAATTAATTAGGGAAATGAAATCTGTA
ATTGAAGAATTCAAATCCAAATTCGCTTAGACCAAAAAAAATATAGAAATTGTAGAAAAG
TATTCTACCATGGAAAGAGAGCTAATGAAGCTAAAGCTAGAAAAGGATACTCTTCAATCA
GAATTAAAGGCCTAAATCTAAGAAGATTATGAAGACTAGATTGAATAGCTTAAGCTATCT
CATAAGCAAGAAGTTACTTCTCTTAAAGATGAATATGAAAAAAAGGTGTCTGATTTCTAA
AAAAAAGTAGAACTTTTATAAGAAGAGTAGTCTAAAAAATCTTAAAAAGTTTAAGAAAAC
GAATCATTAAAAAACAAATAGAATTAGCAAATAGCACTATATAAGACCTTCGTAAAGATG
CAATACATTCCTAAGGTTCAAGCCTAAAAGAATGAAGATTTAGAAGAAAAAAAGGTGAAT
ATTGATTAGCTAGACTAATAAAAAAATGTTTAAACTTAAAAAAATAAAAATTTGAGATTC
TTCGATGTTGCTGCTAACTTGGGCAGTTCATAGTTTGCAGCAAATGAAGGTGGATGTGAC
AGACTTTTACTTTCCGCTTCTAATTTAAAAGACGCCAAAGAATGCTATTAAATTAGTTAA
ATGAGTGATAAGTTTTATTGTACAGTAGGACTACACCCTGCTAAAGCTAATGAAGCTGAT
TAAAACACTAATAACTACTTTAATTAGTTAGATGGGCTTATATAGAAGTATGGTAAAAAA
TGTGTTGCTGTGGGAGAATGCGGTTTGGATTATGATAGATTGTTTTGCTCTAAAAAAGAT
GTTTAGCTGAAGAGATTTACAAATGGATTAGTTCACTCTTATACAGGTGGTATAGCTGAG
TTAGAAGAGCTACTCTAAGAAGGTCTTTATATTAGTATTAATGCTTTAACTTTTAAGCAC
AAAAAAGACTATGAAGTAGTTAAAAGAATTCCTTTAGATAGAATTATGATTGAAACAGAT
GCCCCTTATTGTAAAATAAAGCCTTCTGATGATGGTTTTTCTCTGCTTACTTCAGAAGAG
CCTCAATTTATAAAAAAAGAAAAATATCAAAAGGGATTTTTTATATAAGGTAGAAATGAA
CCATATTTTGTTAGAGAAGTTAGCTAAATGTTATCAGCTGTGCTTGAAAAAGATGAATAT
GAGATTGCAGAATAGTGTTATTAAAACTCTCTCAAATTTTTCAATATTTAAGAGTGA


>TTHERM_00334280(protein)
MQNIGLNQVKDRILILSPIVQGRLESELKTSDFQVLDRLGKGAFGKVYKTKLQKTGQIFA
LKQMEKQQILKQGMVKQIQTEVKVMYSLDHPNIIKLYNHFEEDAYIYLMIEYASGGQLWQ
KLTKEGRFDENTVKRYMADIILAVEYLHSQNPPIIHRDIKPENLILDENGRVKLVDFGWS
NFKNRLRMTYCGTLDYLAPEMILELGHDEKLDIWSLGVLIFELITGKAPFAPKVENANID
QNQARQILEDNILKVKLDYPNDFPQLAKDLVNNLCKKEPNQRKTLPEIKKHPWFIIESEG
KNIFEMEPWNYRPLASQKYKYCLTPNQINPLKLEGGFTPQFIADFATRLHQPLVMNILQQ
IAQKSQQNGNANPQLTQSGQSQNMNASQTSQQNQSNYEEEILNLKKKIASREQEKQDLES
QKKELIVKLEVKERENTKLKDELDKYKSIGQDSTPTEQRSVGVSGVNGGIIELIREMKSV
IEEFKSKFAQTKKNIEIVEKYSTMERELMKLKLEKDTLQSELKAQIQEDYEDQIEQLKLS
HKQEVTSLKDEYEKKVSDFQKKVELLQEEQSKKSQKVQENESLKNKQNQQIALYKTFVKM
QYIPKVQAQKNEDLEEKKVNIDQLDQQKNVQTQKNKNLRFFDVAANLGSSQFAANEGGCD
RLLLSASNLKDAKECYQISQMSDKFYCTVGLHPAKANEADQNTNNYFNQLDGLIQKYGKK
CVAVGECGLDYDRLFCSKKDVQLKRFTNGLVHSYTGGIAELEELLQEGLYISINALTFKH
KKDYEVVKRIPLDRIMIETDAPYCKIKPSDDGFSLLTSEEPQFIKKEKYQKGFFIQGRNE
PYFVREVSQMLSAVLEKDEYEIAEQCYQNSLKFFNIQE


>TTHERM_00334280(gene)
ATGCAAAATATTGGGTTAAATTAAGTTAAAGATAGAATCCTTATACTAAGTCCTATAGTA
TAAGGGCGACTTGAAAGTGAGTTAAAAACCTCAGACTTTTAAGTTTTGGATAGATTAGGC
AAAGGAGCATTTGGCAAAGTTTACAAAACAAAACTATAAAAAACAGGATAGATTTTTGCA
TTAAAATAAATGGAAAAATAGCAAATATTGAAGTAAGGTATGGTAAAGCAAATCTAAACA
GAGGTGAAAGTTATGTATAGCTTGGATCATCCTAATATAATAAAACTATATAATCATTTT
GAAGAAGATGCCTATATTTATTTAATGATTGAATATGCATCAGGTGGTTAACTTTGGTAA
AAACTAACAAAAGAAGGTAGATTTGATGAAAACACAGTTAAAAGATATATGGCTGATATC
ATCCTTGCTGTTGAATATTTACATAGCTAAAACCCTCCAATTATTCATCGTGATATAAAA
CCTGAAAATTTAATCTTAGATGAAAACGGAAGAGTTAAATTAGTAGATTTTGGTTGGTCA
AACTTTAAAAATCGTCTGCGTATGACTTACTGTGGAACTCTTGATTATCTTGCCCCAGAA
ATGATTTTAGAATTAGGGCACGATGAAAAGTTAGATATCTGGAGTCTCGGTGTTTTGATT
TTTGAATTAATCACAGGGAAAGCTCCATTTGCTCCAAAGGTCGAGAATGCTAACATTGAT
TAAAACCAAGCAAGGTAAATATTAGAAGACAATATATTAAAAGTTAAACTTGACTATCCA
AACGACTTTCCTCAATTAGCTAAAGATTTAGTTAATAATTTATGTAAAAAAGAACCTAAT
TAGCGTAAAACACTTCCTGAAATAAAAAAGCACCCATGGTTTATAATTGAAAGCGAAGGT
AAAAACATTTTTGAAATGGAACCTTGGAATTATAGACCTCTTGCAAGTTAAAAGTATAAA
TATTGCTTAACACCAAATTAAATTAATCCCCTTAAGCTTGAAGGAGGTTTTACACCATAA
TTTATTGCCGATTTTGCTACTCGCTTACATTAGCCTTTAGTAATGAATATCCTTCAACAA
ATAGCTTAAAAAAGCTAGTAGAATGGTAATGCTAATCCTTAACTTACATAAAGTGGTTAA
AGCTAAAATATGAATGCATCTTAAACTAGCTAATAAAACTAAAGCAATTATGAGGTAATT
CAAAGCAATGATTAACAAATTATTTCAATTTAAAACATTTATTTAACAATAAATTTTTTT
AAAATTCTTTTATAAATCATTAATTAATTGAATAACATTTTCTTTTGGAAAACTTAAAAT
TATTTTTTTTTTAAATTAAGGAAGAAATTTTAAATCTCAAAAAGAAAATTGCTTCTAGGG
AATAAGAAAAATAAGACCTTGAATCGTAAAAAAAAGAATTGATAGTAAAATTAGAAGTGA
AAGAAAGGGAAAATACTAAGTTAAAAGATGAATTAGATAAATATAAATCAATAGGGCAAG
ACTCAACTCCAACTGAGCAGAGAAGGTAGATTCTTTAGAATGAAGAAATTGAATAGCTTA
AAAAAGAAAAAGAAGAACTTTATGAGAAGTAAAATGAGTATGAAAATTAAATCAAATAAC
TTTAAAGCGACTTAAAAAAAATATAAGATTCAAGAAAGGATTATGAAAAATATAAAATCG
AAAAGTAATAACTTAATGAAAAAATTAAAAAATTTTAAGAAAGCAGAGAATAAGACAATT
CAGATTATCTTGAAAAACTTCAAAGTAAAGAATAAGAACTTAGTATACTATAATTCAAGC
TAAATTAATATGAAAAATCAAAAAGTGTTGGAGTCAGTGGAGTTAATGGAGGAATAATTG
AATTAATTAGGGAAATGAAATCTGTAATTGAAGAATTCAAATCCAAATTCGCTTAGACCA
AAAAAAATATAGAAATTGTAGAAAAGTATTCTACCATGGAAAGAGAGCTAATGAAGCTAA
AGCTAGAAAAGGATACTCTTCAATCAGAATTAAAGGCCTAAATCTAAGAAGATTATGAAG
ACTAGATTGAATAGCTTAAGCTATCTCATAAGCAAGAAGTTACTTCTCTTAAAGATGAAT
ATGAAAAAAAGGTGTCTGATTTCTAAAAAAAAGTAGAACTTTTATAAGAAGAGTAGTCTA
AAAAATCTTAAAAAGTTTAAGAAAACGAATCATTAAAAAACAAATAGAATTAGCAAATAG
CACTATATAAGACCTTCGTAAAGAGTAAGAGTTAAGTAAAGAAGTTAGAAAAAACTTAGA
AAGAAGACTCAAAGACTGTGAAATTGAGATATAGGATTACTAGTAAATGTTAAGAAACTA
TAAAAACAATTCAATAAAAAAATGAAACTAAAATTTTTTTATTTTAATCTATTTTCTCTT
ATAGTTAATGCAAATTAATAAATAAATAATTCAAACTGTTTAACAAAATTTTTTAAATTG
TTTAATAATAAAACATTTTTTTTTCAAACTTCATTTATTTATTAACTATTTCATAAAAAA
ATAAAGTTAAAAATGTATTTAGAAAAACTAATAAATTTCTTAATGATATAAAAGAAATTA
AATTATAAGTAATTTTTTAATTATTTAAAGCAAAAGTGTGTTATTAATTAGCTTTTATTT
ACTTATATTTATTCTGGAATCTTAAATAATACCAAAATAATTGAGTAAAATACGAAAACT
AATTCTATTTTGATTTATTTTTATAATAAAATCATTAAAATATTAAATTATTTCATATGA
AATTAATAAATTTCCTTTTAAATATAATCATGAAGAATTAAGGTAAAAAATAATCTAAAT
AAAAAATGAATAATAAAAAAATTTGTTAAATAAATAAATAGATTTATTTTCCAGAAAAAA
TTAATTAATAACTACTTACACTGATACTAATATTTTTGATTATTGTAAATTGGATAGAAG
AATTATTATTTACCACTTTTCTAAAAATTAAATTCAGTTTAAATTTAGCTTAAAATGTAA
AAAGTGTCTATTGGTTGTTGATCAAATCAATGTGTGATGATCAAAAACAAATTGTACAAT
ATATAATTATAAATAATTAACAAAAAAACATATAATAAGTTTAGTTAAAAGATACTCTCT
TAAAAAATGTCAGAGTGGGATATGCCTATTTACGTACCAAAAAATCAATAAAACAAGCCA
TAGCAAATTTAATAAAGTAAAGAAGCTTAACAAAATCATTATCAATAAACCAATAAAAGT
AAAGTGCAATACATTCCTAAGGTTCAAGCCTAAAAGAATGAAGATTTAGAAGAAAAAAAG
GTGAATATTGATTAGCTAGACTAATAAAAAAATGTTTAAACTTAAAAAAATAAAAATTTG
AGATTCTTCGATGTTGCTGCTAACTTGGGCAGTTCATAGTTTGCAGGTTTTATAAAGGTA
AAAAATTTCATGAAAATGATGTTAAGGATGTTATTTAAAGAGCAAATGAAGGTGGATGTG
ACAGACTTTTACTTTCCGCTTCTAATTTAAAAGACGCCAAAGAATGCTATTAAATTAGTT
AAATGAGTGATAAGTTTTATTGTACAGTAGGACTACACCCTGCTAAAGCTAATGAAGCTG
ATTAAAACACTAATAACTACTTTAATTAGTTAGATGGGCTTATATAGAAGTATGGTAAAA
AATGTGTTGCTGTGGGAGAATGCGGTTTGGATTATGATAGATTGTTTTGCTCTAAAAAAG
ATGTTTAGCTGAAGGTATTTGAAGCTCACTTTAATCTATCTGAAAAGCACTAACTTCCAT
TATATCTACATAGTAGAAATTCAAGAGAGGATTTTTTGAATATTTTACAAAAAAATAAAA
AGAGATTTACAAATGGATTAGTTCACTCTTATACAGGTAATTTAATAGCACAAATGATAA
TAAAAATGTTTAAAAAATTACTAAATCAATTAATTAGGTGGTATAGCTGAGTTAGAAGAG
CTACTCTAAGAAGGTCTTTATATTAGTATTAATGCTTTAACTTTTAAGCACAAAAAAGAC
TATGAAGTAGTTAAAAGAATTCCTTTAGATAGAATTATGATTGAAACAGATGCCCCTTAT
TGTAAAATAAAGCCTTCTGATGATGGTTTTTCTCTGCTTACTTCAGAAGAGCCTCAATTT
ATAAAAAAAGAAAAATATCAAAAGGGATTTTTTATATAAGGTAGAAATGAACCATATTTT
GTTAGAGAAGTTAGCTAAATGTTATCAGCTGTGCTTGAAAAAGATGAATATGAGATTGCA
GAATAGTGTTATTAAAACTCTCTCAAATTTTTCAATATTTAAGAGTGA