Identifiers and Description

Gene Model Identifier

TTHERM_00558620

Standard Name

ATU1 (Alpha-TUbulin 1)

Aliases

PreTt07958 | 73.m00202 | 3735.m00096

Description

Alpha-tubulin; involved in microtubule formation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00091 ) Tubulin/FtsZ family, GTPase domain
  • ( PF03953 ) tubulin/FtsZ family, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.9%

TetraMine Data

TTHERM_00558620

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD02586 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E445D,E447D and neo replacing coding of some ATU1 genes
  • ( SD02746 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E443K and neo replacing coding of some ATU1 genes
  • ( SD01828 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E438A or neo replacing coding of some ATU1 genes
  • ( SD01829 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E443A or neo replacing coding of some ATU1 genes
  • ( SD01830 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E445A or neo replacing coding of some ATU1 genes
  • ( SD01831 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E447A or neo replacing coding of some ATU1 genes
  • ( SD01832 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E445A,E447A and neo replacing coding of some ATU1 genes
  • ( SD01836 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 withE443A, E445A,E446A,E447A and neo replacing coding of some ATU1 genes
  • ( SD01837 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E443D, E445D,E446D,E447D or neo replacing coding of some ATU1 genes
  • ( SD01838 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E438D, E441D, E443D, E445D,E446D,E447D or neo replacing coding of some ATU1 genes
  • ( SD01849 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E446D,E447D and neo replacing coding of some ATU1 genes
  • ( SD01895 ) Micronucleus: neo replaces ATU1 coding Macronucleus: MTT1-ATU1,or neo replacing coding of some ATU1 genes
  • ( SD01900 ) Micronucleus: neo coding replaces ATU1 coding
  • ( SD01901 ) Micronucleus: neo coding replaces ATU1 coding
  • ( SD01902 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E443A, E445A,E446A or neo replacing coding of some ATU1 genes
  • ( SD02225 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E441A, E443A, E445A,E446A,E447A or neo replacing coding of some ATU1 genes
  • ( SD02226 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E441A, E443A, E445A,E446A,E447A or neo replacing coding of some ATU1 genes
  • ( SD02227 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E441A, E443A, E445A,E446A,E447A or neo replacing coding of some ATU1 genes
  • ( SD02228 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E441D, E443D, E445D,E446D,E447D or neo replacing coding of some ATU1 genes
  • ( SD02229 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E441D, E443D, E445D,E446D,E447D or neo replacing coding of some ATU1 genes
  • ( SD02230 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1-HA or neo replacing coding of some ATU1 genes
  • ( SD02558 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E445A,E446A and neo replacing coding of some ATU1 genes
  • ( SD02559 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E446A,E447A and neo replacing coding of some ATU1 genes
  • ( SD02560 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E445A,E446A,E447A and neo replacing coding of some ATU1 genes
  • ( SD02561 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E445A,E446A,E447A and neo replacing coding of some ATU1 genes
  • ( SD02585 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E445D,E446D and neo replacing coding of some ATU1 genes
  • ( SD02593 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E445D,E446D,E447D and neo replacing coding of some ATU1 genes
  • ( SD02709 ) Macronucleus: mutagenized ATU1 gene
  • ( SD02747 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with G444A or neo replacing coding of some ATU1 genes
  • ( SD02748 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with G444A or neo replacing coding of some ATU1 genes
  • ( SD02749 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E446A or neo replacing coding of some ATU1 genes
  • ( SD02750 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with Y449A , assorted to pm-s
  • ( SD02751 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with Y449A, assorted to pm-s
  • ( SD02752 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with ∆Y449 or neo replacing coding of some ATU1 genes
  • ( SD02771 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E445D,
  • ( SD02772 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with E445D, some have neo1 replacing coding
  • ( SD02829 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with R40K, E445A,E446A,E447A and neo replacing coding of some ATU1 genes
  • ( SD02830 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with K40R,E445D,E446D,E447D and neo replacing coding of some ATU1 genes
  • ( SD02871 ) Micronucleus: neo replaces ATU1 coding Macronucleus: ATU1 with PvuII and HaeIII sites

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_148410
WormBaseWBGene000031759.997093137033517e-262locus:mec-12 Tubulin alpha-3
chain status:Confirmed Un
iProt:P91910 protein_id:CCD6
7209.1
Tetrahymena borealisEI9_14430.19.997093137033517e-262tubulin/FtsZ family, GTPase do
main-containing protein (450 a
a)
DictyBaseDDB_G02876899.997093137033517e-262tubA on chromosome: 5 position
707217 to 708704
OxytrichaContig21024.0.g669.997093137033517e-262Tubulin/FtsZ family, GTPase do
main
SGDYML085C9.997093137033517e-262TUB1 Alpha-tubulin; associates
with beta-tubulin (Tub2p) to
form tubulin dimer, which poly
merizes to form microtubules

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:10831613: Xia L, Hai B, Gao Y, Burnette D, Thazhath R, Duan J, Bré MH, Levilliers N, Gorovsky MA, Gaertig J (2000) Polyglycylation of tubulin is essential and affects cell motility and division in Tetrahymena thermophila. The Journal of cell biology 149(5):1097-106
  2. Ref:9037049: Hai B, Gorovsky MA (1997) Germ-line knockout heterokaryons of an essential alpha-tubulin gene enable high-frequency gene replacement and a test of gene transfer from somatic to germ-line nuclei in Tetrahymena thermophila. Proceedings of the National Academy of Sciences of the United States of America 94(4):1310-5

Sequences

>TTHERM_00558620(coding)
ATGAGAGAAGTTATTTCAATTCACGTCGGTCAAGGTGGTATCCAAGTCGGTAACGCCTGT
TGGGAATTATTCTGTCTTGAACACGGTATCTAGCCTGATGGTCAAATGCCCTCTGATAAG
ACTATCGGTGGTGGTGATGATGCTTTCAACACCTTCTTCTCTGAAACTGGTGCCGGTAAG
CACGTCCCCAGAGCTGTCTTCTTAGATCTTGAACCCACTGTCATCGATGAAGTCAGAACT
GGTACCTACAGACAATTATTCCACCCTGAATAATTGATCTCCGGTAAGGAAGATGCCGCT
AACAACTTCGCCAGAGGTCACTACACCATTGGTAAGGAAATCGTCGATCTCTGCTTAGAC
AGAATCAGAAAGTTGGCTGATAACTGTACTGGTCTCCAAGGTTTCTTAGTCTTCAACTCC
GTCGGTGGTGGTACCGGTTCCGGTTTGGGTTCTCTCCTTTTGGAAAGACTCTCCGTCGAT
TACGGTAAGAAATCCAAGTTGGGCTTCACCATCTATCCCTCCCCCTAAGTCTCAACCGCC
GTCGTTGAACCCTACAACTCCATTCTTTCTACTCACTCTTTGTTAGAACACACTGATGTC
GCCGTTATGCTCGATAACGAAGCCATCTATGATATCTGCAGAAGAAACCTCGATATCGAA
AGACCCACCTACACTAACTTGAACAGACTTATTGCTTAAGTTATCTCCTCTTTGACTGCC
TCCCTCAGATTCGATGGTGCCCTTAACGTCGATATCACTGAATTCTAAACTAACTTGGTC
CCCTATCCTAGAATTCACTTTATGCTTTCATCTTATGCTCCTATCATCTCCGCTGAAAAG
GCTTATCACGAATAACTCTCCGTTGCTGAAATCACCAACTCTGCCTTCGAACCCGCTAAC
ATGATGGCTAAGTGTGATCCCAGACACGGTAAGTACATGGCTTGCTCTATGATGTACAGA
GGTGATGTCGTCCCCAAGGATGTCAACGCTTCTATTGCCACCATCAAGACCAAGAGAACC
ATCCAATTCGTCGACTGGTGCCCCACTGGTTTCAAGGTCGGTATTAACTATCAACCCCCC
ACCGTCGTTCCCGGTGGTGATCTTGCTAAGGTCATGAGAGCTGTCTGTATGATTTCCAAC
TCTACTGCCATCGCTGAAGTCTTCTCCAGACTTGACCACAAGTTCGATCTTATGTACGCC
AAGAGAGCCTTCGTCCACTGGTACGTCGGTGAAGGTATGGAAGAAGGTGAATTCTCCGAA
GCCAGAGAAGATCTTGCCGCCCTCGAAAAGGATTACGAAGAAGTCGGTATTGAAACTGCT
GAAGGTGAAGGTGAAGAAGAAGGTTACTGA


>TTHERM_00558620(protein)
MREVISIHVGQGGIQVGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK
HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
VVEPYNSILSTHSLLEHTDVAVMLDNEAIYDICRRNLDIERPTYTNLNRLIAQVISSLTA
SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVAEITNSAFEPAN
MMAKCDPRHGKYMACSMMYRGDVVPKDVNASIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVMRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGIETAEGEGEEEGY


>TTHERM_00558620(gene)
ATGAGAGAAGTTATTTCAATTCACGTCGGTCAAGGTGGTATCCAAGTCGGTAACGCCTGT
TGGGAATTATTCTGTCTTGAACACGGTATCTAGCCTGATGGTCAAATGCCCTCTGATAAG
ACTATCGGTGGTGGTGATGATGCTTTCAACACCTTCTTCTCTGAAACTGGTGCCGGTAAG
CACGTCCCCAGAGCTGTCTTCTTAGATCTTGAACCCACTGTCATCGATGAAGTCAGAACT
GGTACCTACAGACAATTATTCCACCCTGAATAATTGATCTCCGGTAAGGAAGATGCCGCT
AACAACTTCGCCAGAGGTCACTACACCATTGGTAAGGAAATCGTCGATCTCTGCTTAGAC
AGAATCAGAAAGTTGGCTGATAACTGTACTGGTCTCCAAGGTTTCTTAGTCTTCAACTCC
GTCGGTGGTGGTACCGGTTCCGGTTTGGGTTCTCTCCTTTTGGAAAGACTCTCCGTCGAT
TACGGTAAGAAATCCAAGTTGGGCTTCACCATCTATCCCTCCCCCTAAGTCTCAACCGCC
GTCGTTGAACCCTACAACTCCATTCTTTCTACTCACTCTTTGTTAGAACACACTGATGTC
GCCGTTATGCTCGATAACGAAGCCATCTATGATATCTGCAGAAGAAACCTCGATATCGAA
AGACCCACCTACACTAACTTGAACAGACTTATTGCTTAAGTTATCTCCTCTTTGACTGCC
TCCCTCAGATTCGATGGTGCCCTTAACGTCGATATCACTGAATTCTAAACTAACTTGGTC
CCCTATCCTAGAATTCACTTTATGCTTTCATCTTATGCTCCTATCATCTCCGCTGAAAAG
GCTTATCACGAATAACTCTCCGTTGCTGAAATCACCAACTCTGCCTTCGAACCCGCTAAC
ATGATGGCTAAGTGTGATCCCAGACACGGTAAGTACATGGCTTGCTCTATGATGTACAGA
GGTGATGTCGTCCCCAAGGATGTCAACGCTTCTATTGCCACCATCAAGACCAAGAGAACC
ATCCAATTCGTCGACTGGTGCCCCACTGGTTTCAAGGTCGGTATTAACTATCAACCCCCC
ACCGTCGTTCCCGGTGGTGATCTTGCTAAGGTCATGAGAGCTGTCTGTATGATTTCCAAC
TCTACTGCCATCGCTGAAGTCTTCTCCAGACTTGACCACAAGTTCGATCTTATGTACGCC
AAGAGAGCCTTCGTCCACTGGTACGTCGGTGAAGGTATGGAAGAAGGTGAATTCTCCGAA
GCCAGAGAAGATCTTGCCGCCCTCGAAAAGGATTACGAAGAAGTCGGTATTGAAACTGCT
GAAGGTGAAGGTGAAGAAGAAGGTTACTGA