Identifiers and Description

Gene Model Identifier

TTHERM_00558620

Standard Name

ATU1 (Alpha-TUbulin)

Aliases

PreTt07958 | 73.m00202 | 3735.m00096

Description

Alpha-tubulin; axonemal form is modified by non-es...

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00091 ) Tubulin/FtsZ family, GTPase domain
  • ( PF03953 ) tubulin/FtsZ family, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00558620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_148410
WormBaseWBGene000031759.997093137033517e-262locus:mec-12 Tubulin alpha-3
chain status:Confirmed Un
iProt:P91910 protein_id:CCD6
7209.1
Tetrahymena borealisEI9_14430.19.997093137033517e-262tubulin/FtsZ family, GTPase do
main-containing protein (450 a
a)
DictyBaseDDB_G02876899.997093137033517e-262tubA on chromosome: 5 position
707217 to 708704
OxytrichaContig21024.0.g669.997093137033517e-262Tubulin/FtsZ family, GTPase do
main
SGDYML085C9.997093137033517e-262TUB1 Alpha-tubulin; associates
with beta-tubulin (Tub2p) to
form tubulin dimer, which poly
merizes to form microtubules

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00558620(coding)
ATGAGAGAAGTTATTTCAATTCACGTCGGTCAAGGTGGTATCCAAGTCGGTAACGCCTGT
TGGGAATTATTCTGTCTTGAACACGGTATCTAGCCTGATGGTCAAATGCCCTCTGATAAG
ACTATCGGTGGTGGTGATGATGCTTTCAACACCTTCTTCTCTGAAACTGGTGCCGGTAAG
CACGTCCCCAGAGCTGTCTTCTTAGATCTTGAACCCACTGTCATCGATGAAGTCAGAACT
GGTACCTACAGACAATTATTCCACCCTGAATAATTGATCTCCGGTAAGGAAGATGCCGCT
AACAACTTCGCCAGAGGTCACTACACCATTGGTAAGGAAATCGTCGATCTCTGCTTAGAC
AGAATCAGAAAGTTGGCTGATAACTGTACTGGTCTCCAAGGTTTCTTAGTCTTCAACTCC
GTCGGTGGTGGTACCGGTTCCGGTTTGGGTTCTCTCCTTTTGGAAAGACTCTCCGTCGAT
TACGGTAAGAAATCCAAGTTGGGCTTCACCATCTATCCCTCCCCCTAAGTCTCAACCGCC
GTCGTTGAACCCTACAACTCCATTCTTTCTACTCACTCTTTGTTAGAACACACTGATGTC
GCCGTTATGCTCGATAACGAAGCCATCTATGATATCTGCAGAAGAAACCTCGATATCGAA
AGACCCACCTACACTAACTTGAACAGACTTATTGCTTAAGTTATCTCCTCTTTGACTGCC
TCCCTCAGATTCGATGGTGCCCTTAACGTCGATATCACTGAATTCTAAACTAACTTGGTC
CCCTATCCTAGAATTCACTTTATGCTTTCATCTTATGCTCCTATCATCTCCGCTGAAAAG
GCTTATCACGAATAACTCTCCGTTGCTGAAATCACCAACTCTGCCTTCGAACCCGCTAAC
ATGATGGCTAAGTGTGATCCCAGACACGGTAAGTACATGGCTTGCTCTATGATGTACAGA
GGTGATGTCGTCCCCAAGGATGTCAACGCTTCTATTGCCACCATCAAGACCAAGAGAACC
ATCCAATTCGTCGACTGGTGCCCCACTGGTTTCAAGGTCGGTATTAACTATCAACCCCCC
ACCGTCGTTCCCGGTGGTGATCTTGCTAAGGTCATGAGAGCTGTCTGTATGATTTCCAAC
TCTACTGCCATCGCTGAAGTCTTCTCCAGACTTGACCACAAGTTCGATCTTATGTACGCC
AAGAGAGCCTTCGTCCACTGGTACGTCGGTGAAGGTATGGAAGAAGGTGAATTCTCCGAA
GCCAGAGAAGATCTTGCCGCCCTCGAAAAGGATTACGAAGAAGTCGGTATTGAAACTGCT
GAAGGTGAAGGTGAAGAAGAAGGTTACTGA


>TTHERM_00558620(protein)
MREVISIHVGQGGIQVGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK
HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
VVEPYNSILSTHSLLEHTDVAVMLDNEAIYDICRRNLDIERPTYTNLNRLIAQVISSLTA
SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVAEITNSAFEPAN
MMAKCDPRHGKYMACSMMYRGDVVPKDVNASIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVMRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGIETAEGEGEEEGY


>TTHERM_00558620(gene)
ATGAGAGAAGTTATTTCAATTCACGTCGGTCAAGGTGGTATCCAAGTCGGTAACGCCTGT
TGGGAATTATTCTGTCTTGAACACGGTATCTAGCCTGATGGTCAAATGCCCTCTGATAAG
ACTATCGGTGGTGGTGATGATGCTTTCAACACCTTCTTCTCTGAAACTGGTGCCGGTAAG
CACGTCCCCAGAGCTGTCTTCTTAGATCTTGAACCCACTGTCATCGATGAAGTCAGAACT
GGTACCTACAGACAATTATTCCACCCTGAATAATTGATCTCCGGTAAGGAAGATGCCGCT
AACAACTTCGCCAGAGGTCACTACACCATTGGTAAGGAAATCGTCGATCTCTGCTTAGAC
AGAATCAGAAAGTTGGCTGATAACTGTACTGGTCTCCAAGGTTTCTTAGTCTTCAACTCC
GTCGGTGGTGGTACCGGTTCCGGTTTGGGTTCTCTCCTTTTGGAAAGACTCTCCGTCGAT
TACGGTAAGAAATCCAAGTTGGGCTTCACCATCTATCCCTCCCCCTAAGTCTCAACCGCC
GTCGTTGAACCCTACAACTCCATTCTTTCTACTCACTCTTTGTTAGAACACACTGATGTC
GCCGTTATGCTCGATAACGAAGCCATCTATGATATCTGCAGAAGAAACCTCGATATCGAA
AGACCCACCTACACTAACTTGAACAGACTTATTGCTTAAGTTATCTCCTCTTTGACTGCC
TCCCTCAGATTCGATGGTGCCCTTAACGTCGATATCACTGAATTCTAAACTAACTTGGTC
CCCTATCCTAGAATTCACTTTATGCTTTCATCTTATGCTCCTATCATCTCCGCTGAAAAG
GCTTATCACGAATAACTCTCCGTTGCTGAAATCACCAACTCTGCCTTCGAACCCGCTAAC
ATGATGGCTAAGTGTGATCCCAGACACGGTAAGTACATGGCTTGCTCTATGATGTACAGA
GGTGATGTCGTCCCCAAGGATGTCAACGCTTCTATTGCCACCATCAAGACCAAGAGAACC
ATCCAATTCGTCGACTGGTGCCCCACTGGTTTCAAGGTCGGTATTAACTATCAACCCCCC
ACCGTCGTTCCCGGTGGTGATCTTGCTAAGGTCATGAGAGCTGTCTGTATGATTTCCAAC
TCTACTGCCATCGCTGAAGTCTTCTCCAGACTTGACCACAAGTTCGATCTTATGTACGCC
AAGAGAGCCTTCGTCCACTGGTACGTCGGTGAAGGTATGGAAGAAGGTGAATTCTCCGAA
GCCAGAGAAGATCTTGCCGCCCTCGAAAAGGATTACGAAGAAGTCGGTATTGAAACTGCT
GAAGGTGAAGGTGAAGAAGAAGGTTACTGA